Recombinant Human adenovirus E serotype 4 Fiber protein (L5)

Thanks for your inquiry.
1.Recombinant Human adenovirus E serotype 4 Fiber protein(L5)
Expression Region: 1-426aa; Full length.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

MSKSARGWSDGFDPVYPYDADNDRPCPSSTLPSFSSDGFQEKPLGVLSLGPGRPCHTKNGEITLKLGEGVDLDDSGKLIANTVNKAIAPLSFFQQHHFLTWIPLYTPKMENYPYKFLPPLSILKSTILNTLVSAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNRGLHVTTGDAIESNISWAKGIKFEDGAIATNIGKGSRFGTSSTETGVNNAYPIQVKLGSGLSFDSTGAIMAGNKDYDKLTLWTTPDPSPNCQILAENDAKLTLCLTMCDSQILATVSVLVVRSGNLNPITGTVSSAQVFLRFDANGVLLTEHSTSKKYWGYKQGDSIDGTPYTNAVGFMPNSTAYPKTQSSTTKNNIVGQVYMNGDVSKPMLLTITLNGTDDTTSAYSMSFSYTWTNGSYIGATFGANSYTFSYIAQQ

2.Recombinant Human adenovirus C serotype 5 Fiber protein(L5) ,partial
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLRLSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLEISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPLTVSEGKLALQTSGPLTTTDSSTLTITASPPLTTATGSLGIDLKEPIYTQNGKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGNMQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLDINYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPNAPNTNPLKTKIGHGLEFDSNKAMVPKLGTGLSFDSTGAITVG

Pls feel free to contact us if you are interesed in some other expression regions, we will check if we can provide.
① You can find that the sequence of these two proteins are very different through the sequence comparison, the similarity is not high. See the sequence blast result below.
② Sorry, for the time being, we haven't expressed any of these proteins, so we can't provide the related gel picture of the purified fiber.
The main difference of the protein expressed by four different expression systems lie in the post-translational modification.
The protein expressed by E.coli expression system doesn't have post-translational modification(eg: glycosylation, phosphorylation, etc.),
and the other three systems can perform post-translational modifications, but the type and degree of modification are different.
The Yeast expression system have N-type and O-type glycosylation modification but its mechanism is different from that of higher eukaryotic expression systems,
The glycosylation modifications are mainly high mannose glycosylation modifications (such as yeast-specific O-mannosylation), lacking complex sugar chain modifications.
Baculovirus expression system has O-type glycosylation and high mannose N-type glycosylation, but it is generally not possible to perform peripheral glycosylation (eg, sialic acid N-glycosylation). The mammalian cells expression system has most thorough of glycosylation that can provide complex N-glycosylation and accurate O-glycosylation.