Recombinant Listeria monocytogenes serotype 4a UPF0042 nucleotide-binding protein LMHCC_0126 (LMHCC_0126)

Product Type Recombinant Protein
Uniprot No. B8DBN7
Species Listeria monocytogenes serotype 4a (strain HCC23)
Gene Names LMHCC_0126
Protein Names Recommended name: UPF0042 nucleotide-binding protein LMHCC_0126
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Displays ATPase and GTPase activities.
Protein Families RapZ-like family
Database Links

KEGG: lmh:LMHCC_0126

Product Details for Different Expression Systems

Product Name Recombinant Listeria monocytogenes serotype 4a UPF0042 nucleotide-binding protein LMHCC_0126 (LMHCC_0126),Yeast
Code CSB-YP491003LPW
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTSKQLKLVIITGMSGAGKTVAMQSLEDLGYFCVDNLPPSLLPKFWELMKESDKMDKIAL VMDLRGREFFDSIEPALDELDNTNFITTKILFLEADDKVLVSRYKETRRHHPLEPNGSVL DGINAERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTEDKDVFNVQLMSFGFKYGI PIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPETQTFLDKLVDLLMFTLPFY KREGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQKYETTISHRDMKRRKGR
Expression Region 1-291
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Listeria monocytogenes serotype 4a UPF0042 nucleotide-binding protein LMHCC_0126 (LMHCC_0126),E.coli
Code CSB-EP491003LPW
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTSKQLKLVIITGMSGAGKTVAMQSLEDLGYFCVDNLPPSLLPKFWELMKESDKMDKIAL VMDLRGREFFDSIEPALDELDNTNFITTKILFLEADDKVLVSRYKETRRHHPLEPNGSVL DGINAERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTEDKDVFNVQLMSFGFKYGI PIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPETQTFLDKLVDLLMFTLPFY KREGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQKYETTISHRDMKRRKGR
Expression Region 1-291
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Listeria monocytogenes serotype 4a UPF0042 nucleotide-binding protein LMHCC_0126 (LMHCC_0126),Baculovirus
Code CSB-BP491003LPW
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTSKQLKLVIITGMSGAGKTVAMQSLEDLGYFCVDNLPPSLLPKFWELMKESDKMDKIAL VMDLRGREFFDSIEPALDELDNTNFITTKILFLEADDKVLVSRYKETRRHHPLEPNGSVL DGINAERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTEDKDVFNVQLMSFGFKYGI PIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPETQTFLDKLVDLLMFTLPFY KREGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQKYETTISHRDMKRRKGR
Expression Region 1-291
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Listeria monocytogenes serotype 4a UPF0042 nucleotide-binding protein LMHCC_0126 (LMHCC_0126),Mammalian cell
Code CSB-MP491003LPW
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTSKQLKLVIITGMSGAGKTVAMQSLEDLGYFCVDNLPPSLLPKFWELMKESDKMDKIAL VMDLRGREFFDSIEPALDELDNTNFITTKILFLEADDKVLVSRYKETRRHHPLEPNGSVL DGINAERELLSDLKGRSQLVINTSNMAPRELRERINNEFQTEDKDVFNVQLMSFGFKYGI PIDADLVFDVRFLPNPHYIDKMRPLTGLDEDVYEYVMKWPETQTFLDKLVDLLMFTLPFY KREGKTQLVIAIGCTGGQHRSVALTEFVGKAIQQKYETTISHRDMKRRKGR
Expression Region 1-291
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.