Recombinant Maricaulis maris Glutamate--tRNA ligase 1(gltX1)

Product Type Recombinant Protein
Uniprot No. Q0AR08
Abbreviation gltX1
Species Maricaulis maris (strain MCS10)
Gene Names gltX1
Protein Names Recommended name: Glutamate--tRNA ligase 1 EC= 6.1.1.17 Alternative name(s): Glutamyl-tRNA synthetase 1 Short name= GluRS 1
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction
Subcellular Location Cytoplasm
Protein Families Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily
Database Links

KEGG: mmr:Mmar10_0986

STRING: 394221.Mmar10_0986

Product Details for Different Expression Systems

Product Name Recombinant Maricaulis maris Glutamate--tRNA ligase 1(gltX1),Yeast
Code CSB-YP603322
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTKVRFAPSPTGKLHVGNVRTAIFNYLFARKAGGTFVLRIDDTDVERSTKAYEDGIRADL TWLGISWDETFKQSDRFDRYEAAAETLKAKGLLYPCYETGEDLDRKRRLQMANGRPPVYD RAALDLTDAEKAGFEAEGRKPHWRFKLSGNPVQWDDMVRGHVSIETSSLSDPILIREDGS FLYTLPSVLDDIESEITHIIRGEDHTTNSGAQIEIFEALGGKAPIFGHQALLVGADGGKL SKRTGSLGIADLRDVDGLEPMAIMSLLARIGTSDPVEAFADVEGILEGFDLGKLSRSPAR FDDEELKRVNAKLLHAMPYDVAQPKLAVLGADKGEAVWEAVRPNLETLADAKAWAVLIDG PVTPVIEEPDYAAAAAQHLPAGELDGDSWSVWTNALKEATGRKGKQLFMPLRLMLTGEAR GPEMAVLLPLIGRDKVLKRLAGEAA
Expression Region 1-445
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Maricaulis maris Glutamate--tRNA ligase 1(gltX1),E.coli
Code CSB-EP603322
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTKVRFAPSPTGKLHVGNVRTAIFNYLFARKAGGTFVLRIDDTDVERSTKAYEDGIRADL TWLGISWDETFKQSDRFDRYEAAAETLKAKGLLYPCYETGEDLDRKRRLQMANGRPPVYD RAALDLTDAEKAGFEAEGRKPHWRFKLSGNPVQWDDMVRGHVSIETSSLSDPILIREDGS FLYTLPSVLDDIESEITHIIRGEDHTTNSGAQIEIFEALGGKAPIFGHQALLVGADGGKL SKRTGSLGIADLRDVDGLEPMAIMSLLARIGTSDPVEAFADVEGILEGFDLGKLSRSPAR FDDEELKRVNAKLLHAMPYDVAQPKLAVLGADKGEAVWEAVRPNLETLADAKAWAVLIDG PVTPVIEEPDYAAAAAQHLPAGELDGDSWSVWTNALKEATGRKGKQLFMPLRLMLTGEAR GPEMAVLLPLIGRDKVLKRLAGEAA
Expression Region 1-445
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Maricaulis maris Glutamate--tRNA ligase 1(gltX1),Baculovirus
Code CSB-BP603322
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTKVRFAPSPTGKLHVGNVRTAIFNYLFARKAGGTFVLRIDDTDVERSTKAYEDGIRADL TWLGISWDETFKQSDRFDRYEAAAETLKAKGLLYPCYETGEDLDRKRRLQMANGRPPVYD RAALDLTDAEKAGFEAEGRKPHWRFKLSGNPVQWDDMVRGHVSIETSSLSDPILIREDGS FLYTLPSVLDDIESEITHIIRGEDHTTNSGAQIEIFEALGGKAPIFGHQALLVGADGGKL SKRTGSLGIADLRDVDGLEPMAIMSLLARIGTSDPVEAFADVEGILEGFDLGKLSRSPAR FDDEELKRVNAKLLHAMPYDVAQPKLAVLGADKGEAVWEAVRPNLETLADAKAWAVLIDG PVTPVIEEPDYAAAAAQHLPAGELDGDSWSVWTNALKEATGRKGKQLFMPLRLMLTGEAR GPEMAVLLPLIGRDKVLKRLAGEAA
Expression Region 1-445
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Maricaulis maris Glutamate--tRNA ligase 1(gltX1),Mammalian cell
Code CSB-MP603322
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTKVRFAPSPTGKLHVGNVRTAIFNYLFARKAGGTFVLRIDDTDVERSTKAYEDGIRADL TWLGISWDETFKQSDRFDRYEAAAETLKAKGLLYPCYETGEDLDRKRRLQMANGRPPVYD RAALDLTDAEKAGFEAEGRKPHWRFKLSGNPVQWDDMVRGHVSIETSSLSDPILIREDGS FLYTLPSVLDDIESEITHIIRGEDHTTNSGAQIEIFEALGGKAPIFGHQALLVGADGGKL SKRTGSLGIADLRDVDGLEPMAIMSLLARIGTSDPVEAFADVEGILEGFDLGKLSRSPAR FDDEELKRVNAKLLHAMPYDVAQPKLAVLGADKGEAVWEAVRPNLETLADAKAWAVLIDG PVTPVIEEPDYAAAAAQHLPAGELDGDSWSVWTNALKEATGRKGKQLFMPLRLMLTGEAR GPEMAVLLPLIGRDKVLKRLAGEAA
Expression Region 1-445
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.