Recombinant Methanosphaerula palustris V-type proton ATPase subunit E(atpE)

Product Type Recombinant Protein
Uniprot No. B8GFR1
Species Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Gene Names atpE
Protein Names Recommended name: V-type proton ATPase subunit E Alternative name(s): V-ATPase subunit E
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Produces ATP from ADP in the presence of a proton gradient across the membrane.
Protein Families V-ATPase E subunit family
Database Links

KEGG: mpl:Mpal_2680

STRING: 521011.Mpal_2680

Product Details for Different Expression Systems

Product Name Recombinant Methanosphaerula palustris V-type proton ATPase subunit E(atpE),Yeast
Code CSB-YP491269MSP
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGLEAVIDEITEKGRKEAEAIRKESETEVAQVLAAANVKSDQIKTAVDEDVARQEARIIN QEVSAANLLVKRSQLNAEKSLLDQVYAAVLLEVRGASPDFHRAALSSLLQQARAEIGEGM IHASARDLPMVQTLLKEGSYPGFVAGSPVDIDGGIIAESRDGLLQVDYSYRTFLDRVWES GLKNASDILFG
Expression Region 1-191
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methanosphaerula palustris V-type proton ATPase subunit E(atpE),E.coli
Code CSB-EP491269MSP
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGLEAVIDEITEKGRKEAEAIRKESETEVAQVLAAANVKSDQIKTAVDEDVARQEARIIN QEVSAANLLVKRSQLNAEKSLLDQVYAAVLLEVRGASPDFHRAALSSLLQQARAEIGEGM IHASARDLPMVQTLLKEGSYPGFVAGSPVDIDGGIIAESRDGLLQVDYSYRTFLDRVWES GLKNASDILFG
Expression Region 1-191
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methanosphaerula palustris V-type proton ATPase subunit E(atpE),Baculovirus
Code CSB-BP491269MSP
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGLEAVIDEITEKGRKEAEAIRKESETEVAQVLAAANVKSDQIKTAVDEDVARQEARIIN QEVSAANLLVKRSQLNAEKSLLDQVYAAVLLEVRGASPDFHRAALSSLLQQARAEIGEGM IHASARDLPMVQTLLKEGSYPGFVAGSPVDIDGGIIAESRDGLLQVDYSYRTFLDRVWES GLKNASDILFG
Expression Region 1-191
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Methanosphaerula palustris V-type proton ATPase subunit E(atpE),Mammalian cell
Code CSB-MP491269MSP
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGLEAVIDEITEKGRKEAEAIRKESETEVAQVLAAANVKSDQIKTAVDEDVARQEARIIN QEVSAANLLVKRSQLNAEKSLLDQVYAAVLLEVRGASPDFHRAALSSLLQQARAEIGEGM IHASARDLPMVQTLLKEGSYPGFVAGSPVDIDGGIIAESRDGLLQVDYSYRTFLDRVWES GLKNASDILFG
Expression Region 1-191
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.