Recombinant Mouse Guanylate cyclase activator 2B(Guca2b)

Code CSB-EP010048MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. O09051
Relevance Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
Research Area Others
Source E.coli
Gene Names Guca2b
Expression Region 22-106aa
Tag Info N-terminal GST-tagged
Mol. Weight 36.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport (By similarity).
Subcellular Location Secreted
Protein Families Guanylin family
Tissue Specificity Localized predominantly in intestinal villi and the corticomedullary junction of the kidney.
Database Links

KEGG: mmu:14916

STRING: 10090.ENSMUSP00000043203

UniGene: Mm.278

Related Products

Guca2b Antibodies

Guca2b Antibodies for Mus musculus (Mouse)

Guca2b Proteins

Guca2b Proteins for Mus musculus (Mouse)

Guca2b ELISA Kit

Guca2b ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.