Recombinant Mouse Homeobox protein SIX5 (Six5)

Code CSB-YP021352MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021352MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021352MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP021352MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP021352MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Six5
Uniprot No.
Alternative Names
Six5; Dmahp; Homeobox protein SIX5; DM locus-associated homeodomain protein homolog; Sine oculis homeobox homolog 5
Species
Mus musculus (Mouse)
Expression Region
1-719
Target Protein Sequence
MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that is thought to be involved in regulation of organogenesis. May be involved in determination and maintenance of retina formation. Binds a 5'-GGTGTCAG-3' motif present in the ARE regulatory element of ATP1A1. Binds a 5'-TCA[AG][AG]TTNC-3' motif present in the MEF3 element in the myogenin promoter, and in the IGFBP5 promoter. Thought to be regulated by association with Dach and Eya proteins, and seems to be coactivated by EYA1, EYA2 and EYA3.
Gene References into Functions
  1. Muscleblind1, but not Dmpk or Six5, contributes to a complex phenotype of muscular and motivational deficits in mouse models of myotonic dystrophy PMID: 20360842
  2. Prolonged QRS duration and delayed infraHisian conduction were significant in adult Six5 heterozygous mice. Left ventricular end-diastolic dimension was enlarged in adult Six5 heterozygous mice. PMID: 12397222
  3. demonstrated a strict requirement of Six5 for both spermatogenic cell survival and spermiogenesis PMID: 15163633
  4. Muscle contractile properties, electromyographic insertional activity, and muscle histology were normal in SIX5 deficient mice. PMID: 15536612
Subcellular Location
Nucleus.
Protein Families
SIX/Sine oculis homeobox family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1