Recombinant Mouse Homeobox protein SIX5(Six5)

Product Type Recombinant Protein
Uniprot No. P70178
Species Mus musculus (Mouse)
Gene Names Six5
Protein Names Recommended name: Homeobox protein SIX5 Alternative name(s): DM locus-associated homeodomain protein homolog Sine oculis homeobox homolog 5
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This protein is a homeodomain-containing transcription factor that appears to function in the regulation of organogenesis. This gene is located downstream of the dystrophia myotonica-protein kinase gene. Mutations in this gene are a cause of branchiootorenal syndrome type 2.
Function Transcription factor that is thought to be involved in regulation of organogenesis. May be involved in determination and maintenance of retina formation. Binds a 5'-GGTGTCAG-3' motif present in the ARE regulatory element of ATP1A1. Binds a 5'-TCA[AG][AG]TTNC-3' motif present in the MEF3 element in the myogenin promoter, and in the IGFBP5 promoter (By similarity). Thought to be regulated by association with Dach and Eya proteins, and seems to be coactivated by EYA1, EYA2 and EYA3.
Subcellular Location Nucleus
Protein Families SIX/Sine oculis homeobox family
Database Links

KEGG: mmu:20475

STRING: 10090.ENSMUSP00000045973

UniGene: Mm.3410

Product Details for Different Expression Systems

Product Name Recombinant Mouse Homeobox protein SIX5(Six5),Yeast
Code CSB-YP021352MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
Expression Region 1-719
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Homeobox protein SIX5(Six5),E.coli
Code CSB-EP021352MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
Expression Region 1-719
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Homeobox protein SIX5(Six5),Baculovirus
Code CSB-BP021352MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
Expression Region 1-719
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Homeobox protein SIX5(Six5),Mammalian cell
Code CSB-MP021352MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATSPAEPSAGPAARGEAAAATEEQEEEARQLLQTLQAAEGEAAAAGAGDAAAAADSGSP SGPGSPRETVTEVPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERLRGSDPVL RARALVAFQRGEYAELYQLLESRPFPAAHHAFLQDLYLRARYHEAERARGRALGAVDKYR LRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGLSLTQVSN WFKNRRQRDRTGTGGGAPCKSESDGNPTTEDESSRSPEDLERGVASMAAEAPAQSSIFLA GATSPATCPASSSILVNGSFLAASSPPAVLLNGSPVIINSLALGENSSLGPLLLTGGSAP QPQPSLQGVSEAKNSLVLDPQTGEVRLDEAQSEAPETKGVHGTTGEEIPGALPQVVPGPP PASTFPLTPGAVPAVAAPQVVPLSPSSGYPTGLSPTSPRLNLPQVVPTSQVVTLPQAVGP LQLLAAGPGSPVKVAAAAGPTNVHLINSSVGVTALQLPSSTAPGNFLLANPVSGSPIVTG VAVQQGKIILTATFPTSMLVSQVLPPAPSLALPLKQEPAITVPEGALPVGPSPTLPEGHT LGPISTQPLPPASVVTSGTSLPFSPDSSGLLSSFSAPLPEGLMLSPAAVPVWPAGLELST GVEGLGTQATHTVLRLPDPDPQGLLLGATTGTEVDEGLEAEAKVLTQLQSVPVEEPLEL
Expression Region 1-719
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.