Recombinant Mouse Membrane primary amine oxidase (Aoc3), partial

Code CSB-YP001855MO1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001855MO1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001855MO1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001855MO1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001855MO1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Aoc3
Uniprot No.
Alternative Names
Aoc3; Vap1; Membrane primary amine oxidase; Copper amine oxidase; Semicarbazide-sensitive amine oxidase; SSAO; Vascular adhesion protein 1; VAP-1
Species
Mus musculus (Mouse)
Expression Region
28-765
Target Protein Sequence
RSGDGGGLSQPLHCPSVLPSVQPRTHPSQSQPFADLSPEELTAVMSFLTKHLGPGLVDAA QARPSDNCVFSVELQLPAKAAALAHLDRGGPPPVREALAIIFFGGQPKPNVSELVVGPLP HPSYMRDVTVERHGGPLPYYRRPVLDREYQDIEEMIFHRELPQASGLLHHCCFYKHQGQN LLTMTTAPRGLQSGDRATWFGLYYNLSGAGFYPHPIGLELLIDHKALDPALWTIQKVFYQ GRYYESLTQLEDQFEAGLVNVVLVPNNGTGGSWSLKSSVPPGPAPPLQFHPQGPRFSVQG SQVSSSLWAFSFGLGAFSGPRIFDIRFQGERVAYEISVQEAIALYGGNSPASMSTCYVDG SFGIGKYSTPLIRGVDCPYLATYVDWHFLLESQAPKTLRDAFCVFEQNQGLPLRRHHSDF YSHYFGGVVGTVLVVRSVSTLLNYDYIWDMVFHPNGAIEVKFHATGYISSAFFFGAGEKF GNRVGAHTLGTVHTHSAHFKVDLDVAGLKNWAWAEDMAFVPTIVPWQPEYQMQRLQVTRK LLETEEEAAFPLGGATPRYLYLASNHSNKWGHRRGYRIQILSFAGKPLPQESPIEKAFTW GRYHLAVTQRKEEEPSSSSIFNQNDPWTPTVNFTDFISNETIAGEDLVAWVTAGFLHIPH AEDIPNTVTAGNSVGFFLRPYNFFDEDPSFHSADSIYFREGQDATACEVNPLACLSQTAT CAPEIPAFSHGGFAYRDN
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis.
Gene References into Functions
  1. Data indicate strong-to-moderate expression of vascular adhesion protein-1 (VAP-1) in the synovium of Borrelia burgdorferi-infected mice, while only weak expression of VAP-1 was detected in uninfected mice. PMID: 29166944
  2. VAP-1 was expressed on endothelial cells lining inflamed atherosclerotic lesions; normal vessel walls in aortas of C57BL/6N control mice were VAP-1-negative. PMID: 27731409
  3. VAP-1 plays a critical role in the pathophysiology of renal ischemia/reperfusion injury by enhancement of neutrophil infiltration generating a local hydrogen peroxide gradient. PMID: 28318627
  4. This study showed that the oxidase activity of AOC3 contributes to the development of lung fibrosis mainly by regulating the accumulation of pathogenic leukocyte subtypes, which drive the fibrotic response. PMID: 28251930
  5. data indicate that SSAO inactivation in vivo stabilizes the established plaques mainly via inducing the switch of SMCs from a contractile to a synthetic phenotype PMID: 27043821
  6. Suggest inhibiting VAP-1/SSAO enzymatic function, by PXS-4728A, as a novel therapeutic approach in lung diseases that are characterized by neutrophilic pattern of inflammation. PMID: 25889951
  7. these results link the amine oxidase activity of VAP-1 with hepatic inflammation and fibrosis and suggest that targeting VAP-1 has therapeutic potential for NAFLD and other chronic fibrotic liver diseases. PMID: 25562318
  8. these results suggest a largely redundant function for AOC3/VAP-1 in allergic inflammatory responses of the airways. PMID: 25116373
  9. The results of the study establish VCAM-1 and VAP-1 as mediators of myeloid cell recruitment in metastasis and identify VAP-1 as a potential target for therapeutic intervention to combat early metastasis. PMID: 23407548
  10. The antihyperglycemic effect of benzylamine is abolished by AOC3 gene knockout in mice. PMID: 22547093
  11. Long-term activation of semicarbazide-sensitive amine oxidase by benzylamine lowers circulating levels of uric acid in diabetic conditions. PMID: 22480418
  12. AOC3 expression is increased in perigonadal and subcutaneous adipose tissue of diabetic db-/- obese mice. PMID: 21298297
  13. This review examines the biological functions of VAP-1, especially the role that this molecule might play in the establishment and progression of chronic liver disease. PMID: 21512782
  14. The demonstrated AOC3 turnover of primary amines that are non-native to human tissue suggests possible roles for the adipocyte enzyme in subcutaneous bacterial infiltration and obesity. PMID: 22238597
  15. VAP-1-mediated M2 macrophage infiltration underlies IL-1beta- but not VEGF-A-induced lymph- and angiogenesis PMID: 21435467
  16. VAP-1 inhibition provided antiinflammation effect by reducing adhesion molecule expression and immune cell infiltration after intracerebral hemorrhage. PMID: 20877383
  17. histamine moderately activated lipolysis in adipocytes in AOC3 knockout mice PMID: 20012150
  18. Enzyme is in involved in deamination in atherogenesis in KKAy diabetic mice fed with high cholesterol diet. PMID: 12242458
  19. the increased enzyme activity observed in diabetes is not a result of increased SSAO gene transcription. It is controlled by posttranslational modifications of the protein, and the catalytic activity controls the gene expression PMID: 12606817
  20. vascular adhesion protein-1 expression may contribute to the functional heterogeneity of endothelial cells within the lung to create distinct sites for the recruitment of inflammatory cells PMID: 12700900
  21. Release of this enzyme is regulated by TNF-alpha and insulin and, in adipose cells could contribute to the atherogenesis and vascular dysfunction associated with diabetes and obesity. PMID: 14968297
  22. The vascular endothelium is the major source of circulating VAP-1 protein and semicarbazide-sensitive amine oxidase activity. PMID: 15178639
  23. VAP-1 mediates leukocyte trafficking to sites of inflammation and thus is a potential target for anti-inflammatory therapies PMID: 15743791
  24. T helper type 2 cells use Vap-1 to roll and adhere in the inflamed liver microcirculation PMID: 16111634
  25. These data demonstrate the potential clinical benefit of small molecule anti-SSAO therapy in this mouse multiple sclerosis model. PMID: 17393060
  26. The effects of exogenous or biogenic amines on glucose transport are not receptor-mediated but are oxidation-dependent. The major SSAO form expressed in mouse adipocytes is encoded by the AOC3 gene. PMID: 17406965
  27. VAP-1-deficient mice have mild deviations in the mucosal immune system PMID: 17947691
  28. The atheroprotective effect of LXR agonist T0901317 is related to the inhibition of SSAO gene expression and its activity. PMID: 18330481
  29. LOX binds to mature TGF-beta1 and enzymatically regulates its signaling in bone via amine oxidase activity, and thus may play an important role in bone maintenance and remodeling PMID: 18835815
  30. VAP-1 regulates the inflammatory response in ischemia-reperfusion injury and suggest that blockade of VAP-1 may have therapeutic value. PMID: 18991279

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Copper/topaquinone oxidase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1