Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial

Product Type Recombinant Protein
Uniprot No. P70218
Species Mus musculus (Mouse)
Gene Names Map4k1
Protein Names Recommended name: Mitogen-activated protein kinase kinase kinase kinase 1 EC= 2.7.11.1 Alternative name(s): Hematopoietic progenitor kinase Short name= HPK MAPK/ERK kinase kinase kinase 1 Short name= MEK kinase kinase 1
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Serine/threonine-protein kinase, which may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. May play a role in hematopoietic lineage decisions and growth regulation. Able to autophosphorylate.
Protein Families Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Tissue Specificity Ubiquitously expressed in all tissues examined at embryonic stage E16.5 with high levels in lung, heart and fetal liver. In the neonate, expression is restricted to the tissues which undergo lineage decisions, lung, thymus, liver, kidney and brain. In the
Database Links

KEGG: mmu:26411

STRING: 10090.ENSMUSP00000082995

UniGene: Mm.148278

Pathway MAPK signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial,Yeast
Code CSB-YP013436MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial,E.coli
Code CSB-EP013436MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial,Baculovirus
Code CSB-BP013436MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial,Mammalian cell
Code CSB-MP013436MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

I want to know mouse HPK1 sequence, tag and activity, did you test the enzymatic activity for MAP4K1(HPK1)?

A:
Regarding your inquiry about mouse HPK1, please check information as follows:
Recombinant Mouse Mitogen-activated protein kinase kinase kinase kinase 1(Map4k1) ,partial
CSB-BP013436MO >> Baculovirus
Expression Region: 15-280aa; Partial.
Tag information: Tag type will be determined during the manufacturing process.
We can try your desired tag preferentially if you have, but as we can't 100% guaranteed, if it's failed, we will provide the protein with other tag. The success rate of expressing the protein with your desired tag is 95.25%.
Target protein sequence: (The whole complete sequence will include tag sequene, target protein sequence and any linker sequence)

EHYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKMEPDDDVATLQKEILMLKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSEKKIHRDIKGANILINDCGEVKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKSRWSSSFHNFVKVTLTKNSKKRPSATKMLSHQLVSQPGLN


As for the activity, sorry, we haven't detected the activity of this protein, we can't 100% guarantee its activity.
The protein that we provide contain a kinase domain and it's purified under a very mild condition, in theory, it should be active.
According to our experience on expression of kinases, some recombinant fragmens with only kinase domain are enzymatic active, such as
human MAP4K1 (http://www.abcam.cn/active-human-map4k1-protein-fragment-ab107953.html)
human MAPK1 (http://emboj.embopress.org/content/embojnl/21/19/5151.full.pdf)
To our knowledge, the kinases from that of STE Ser/Thr protein kinase family, TKL Ser/Thr protein kinase family and Tyrosine-protein kinase family could be expressed with kinase domain.
Customer Reviews

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.