Recombinant Mouse Mothers against decapentaplegic homolog 1(Smad1),Baculovirus

Code CSB-BP021786MO
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P70340
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Storage Buffer PBS pH 7.4, 50% glycerol
Species Mus musculus (Mouse)
Purity >85% (SDS-PAGE)
Sequence MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN SHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ PMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Source Baculovirus
Gene Names Smad1
Protein Names Recommended name: Mothers against decapentaplegic homolog 1 Short name= MAD homolog 1 Short name= Mothers against DPP homolog 1 Alternative name(s): Dwarfin-A Short name= Dwf-A Mothers-against-DPP-related 1 Short name=
Expression Region 1-465
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Protein Description Full length protein
Target Details This protein belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene mothers against decapentaplegic (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD) (By similarity). May play a role in the initiation and maintenance of spermatogenesis. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1 (By similarity). May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression
Subcellular Location Cytoplasm, Nucleus
Protein Families Dwarfin/SMAD family
Tissue Specificity Ubiquitous.
Database Links

KEGG: mmu:17125

STRING: 10090.ENSMUSP00000071035

UniGene: Mm.223717

Pathway Hippo signaling pathway
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Related Products

Smad1 Antibodies

Smad1 Antibodies for Homo sapiens (Human)

Smad1 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

Smad1 Proteins

Smad1 Proteins for Mus musculus (Mouse)

Smad1 Proteins for Rattus norvegicus (Rat)

Smad1 Proteins for Homo sapiens (Human)

Smad1 Proteins for Bos taurus (Bovine)

Smad1 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Smad1 Proteins for Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)

Smad1 cDNA

Smad1 cDNA for Mus musculus (Mouse)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.