Recombinant Mouse SPARC-like protein 1(Sparcl1)

Product Type Recombinant Protein
Uniprot No. P70663
Species Mus musculus (Mouse)
Gene Names Sparcl1
Protein Names Recommended name: SPARC-like protein 1 Alternative name(s): Extracellular matrix protein 2 Matrix glycoprotein Sc1
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families SPARC family
Tissue Specificity Highest expression in brain. Moderate levels in heart, adrenal gland, epididymis and lung. Low levels in kidney, eye, liver, spleen, submandibular gland and testis.
Database Links

KEGG: mmu:13602

STRING: 10090.ENSMUSP00000031249

UniGene: Mm.29027

Product Details for Different Expression Systems

Product Name Recombinant Mouse SPARC-like protein 1(Sparcl1),Yeast
Code CSB-YP022487MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence IPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSDKAEKPSALNSEEETHE QSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSEPQQKSLPENGDFPATV STSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAEESQTQDPDIPNEEEEE EEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQSDDTLEESSQPTQISKT EKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAGLEAIGNQKDTDEKAVS TEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAERMHSLSYYLKYGGGEE TTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCTNFQCKRGHICKTDPQG KPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK SIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAG DHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRASLVPMEHCITRF FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Expression Region 17-650
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse SPARC-like protein 1(Sparcl1),E.coli
Code CSB-EP022487MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence IPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSDKAEKPSALNSEEETHE QSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSEPQQKSLPENGDFPATV STSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAEESQTQDPDIPNEEEEE EEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQSDDTLEESSQPTQISKT EKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAGLEAIGNQKDTDEKAVS TEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAERMHSLSYYLKYGGGEE TTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCTNFQCKRGHICKTDPQG KPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK SIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAG DHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRASLVPMEHCITRF FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Expression Region 17-650
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse SPARC-like protein 1(Sparcl1),Baculovirus
Code CSB-BP022487MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence IPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSDKAEKPSALNSEEETHE QSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSEPQQKSLPENGDFPATV STSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAEESQTQDPDIPNEEEEE EEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQSDDTLEESSQPTQISKT EKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAGLEAIGNQKDTDEKAVS TEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAERMHSLSYYLKYGGGEE TTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCTNFQCKRGHICKTDPQG KPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK SIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAG DHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRASLVPMEHCITRF FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Expression Region 17-650
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse SPARC-like protein 1(Sparcl1),Mammalian cell
Code CSB-MP022487MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence IPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSDKAEKPSALNSEEETHE QSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSEPQQKSLPENGDFPATV STSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAEESQTQDPDIPNEEEEE EEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQSDDTLEESSQPTQISKT EKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAGLEAIGNQKDTDEKAVS TEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAERMHSLSYYLKYGGGEE TTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCTNFQCKRGHICKTDPQG KPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK SIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAG DHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRASLVPMEHCITRF FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Expression Region 17-650
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Sparcl1 ELISA Kit

Sparcl1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.