Recombinant Mouse SPARC-like protein 1(Sparcl1)

Code CSB-YP022487MO
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022487MO
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022487MO-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022487MO
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022487MO
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names Sparcl1
Uniprot No. P70663
Alternative Names Sparcl1; Ecm2; Sc1; SPARC-like protein 1; Extracellular matrix protein 2; Matrix glycoprotein Sc1
Species Mus musculus (Mouse)
Expression Region 17-650
Target Protein Sequence IPTSTRFLSDHSNPTTATLVTPEDATVPIAGVEATADIENHPSDKAEKPSALNSEEETHE QSTEQDKTYSFEVDLKDEEDGDGDLSVDPTEGTLTLDLQEGTSEPQQKSLPENGDFPATV STSYVDPNQRANITKGKESQEQPVSDSHQQPNESSKQTQDLKAEESQTQDPDIPNEEEEE EEDEEEEEEEEPEDIGAPSDNQEEGKEPLEEQPTSKWEGNREQSDDTLEESSQPTQISKT EKHQSEQGNQGQESDSEAEGEDKAAGSKEHIPHTEQQDQEGKAGLEAIGNQKDTDEKAVS TEPTDAAVVPRSHGGAGDNGGGDDSKHGAGDDYFIPSQEFLEAERMHSLSYYLKYGGGEE TTTGESENRREAADNQEAKKAESSPNAEPSDEGNSREHSAGSCTNFQCKRGHICKTDPQG KPHCVCQDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACK SIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQRSKVKKIYLDEKRLLAG DHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRASLVPMEHCITRF FEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Gene References into Functions
  1. tumor endothelial cells heterogeneity is regulated by SPARCL1, which promotes the cell quiescence and vessel homeostasis contributing to the favorable prognoses associated with Th1-tumor microenvironments colorectal carcinomas. PMID: 27721236
  2. Study shows that astrocyte-secreted hevin is a trans-synaptic linker that bridges presynaptic NRX1alpha with postsynaptic NL1B. This way, hevin organizes both pre- and postsynaptic specializations and aligns them across the synapse. PMID: 26771491
  3. Hevin is transiently expressed in the IrrPTK-injured corneas and loss of hevin predisposes them to aberrant wound healing. PMID: 24303054
  4. SC1 and SPARC may share significant homology but are likely to have distinct but complementary roles in central nervous system development. PMID: 22173850
  5. This study presented evidence that combined NL1 and SC1 overexpression triggers excitotoxic neurodegeneration through SC1 signaling at synaptic connections initiated by NL1. PMID: 22542674
  6. In gliomas implanted into murine brain, a SLF was associated with SPARC in the neovasculature but not with hevin, the latter prominent in the astrocytes encompassed by infiltrating tumor PMID: 21688302
  7. These results identify hevin as a positive and SPARC as a negative regulator of synapse formation. PMID: 21788491
  8. Hevin does not appear to be critical to regulating intraocular pressure. Hevin is expressed in trabecular meshwork but, in contrast to SPARC, does not appear to be regulated by TGF-beta2. PMID: 21220554
  9. proteolysis of hevin by ADAMTS4 in the mouse cerebellum is important for the normal development of this tissue PMID: 20018883
  10. determination of collagen I binding and examination of expression in a variety of tissues PMID: 12538579
  11. This hematopoietic stem cell enhancer ia bound by transription factors in stem cells and in hemangioblasts. PMID: 17962413
  12. Data show that Sparcl1 in the locus Rgcs1 region is highly expressed in the ganglion cell layer and optic nerve head. PMID: 18671875

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families SPARC family
Tissue Specificity Highest expression in brain. Moderate levels in heart, adrenal gland, epididymis and lung. Low levels in kidney, eye, liver, spleen, submandibular gland and testis.
Database Links

KEGG: mmu:13602

STRING: 10090.ENSMUSP00000031249

UniGene: Mm.29027

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1