Recombinant Mouse Serine protease inhibitor A3N(Serpina3n)

Product Type Recombinant Protein
Uniprot No. Q91WP6
Abbreviation Serpina3n
Species Mus musculus (Mouse)
Gene Names Serpina3n
Protein Names Recommended name: Serine protease inhibitor A3N Short name= Serpin A3N
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Secreted
Protein Families Serpin family
Tissue Specificity Expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle.
Database Links

STRING: 10090.ENSMUSP00000021506

UniGene: Mm.482074

Product Details for Different Expression Systems

Product Name Recombinant Mouse Serine protease inhibitor A3N(Serpina3n),Baculovirus
Code CSB-BP835578MO(M)
Size Pls inquiry other sizes
Source Baculovirus
Purity Greater than 85% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Expression Region 21-418
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Serine protease inhibitor A3N(Serpina3n),Mammalian cell
Code CSB-MP835578MO(M)
Size Pls inquiry other sizes
Source Mammalian cell
Purity Greater than 85% as determined by SDS-PAGE.
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Expression Region 21-418
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Serpina3n Antibodies

Serpina3n Antibodies for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.