Recombinant Mouse Stimulated by retinoic acid gene 8 protein(Stra8)

Product Type Recombinant Protein
Uniprot No. P70278
Species Mus musculus (Mouse)
Gene Names Stra8
Protein Names Recommended name: Stimulated by retinoic acid gene 8 protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
HGNC 30653
RGD 1562852
MGI 107917
References
Function Meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, required for premeiotic DNA replication and subsequent events in meiotic prophase. During spermatogenesis, next to its role in meiotic initiation, promotes (but is not required for) spermatogonial differentiation. Can associate with DNA (possibly in an indirect manner), and in vitro can activate DNA transcription.
Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Expressed exclusively in premeiotic germ cells in both sexes. In females, is expressed in the embryonic ovary. In males, is expressed in pubertal and adult testes, in premeiotic spermatogenic cells. Expressed by some type A and B spermatogonia, preleptote
Database Links

KEGG: mmu:20899

STRING: 10090.ENSMUSP00000031876

UniGene: Mm.5171

Product Details for Different Expression Systems

Product Name Recombinant Mouse Stimulated by retinoic acid gene 8 protein(Stra8),Yeast
Code CSB-YP022873MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATPGEGNQPSDDGAPQPLAQLQKLEPRVVRRRLSQARHRATLVGLFNNLRKAVYSQSDI TASKWQVLNRTKIHIQEQEESLDKLLKLKASFNLQDGNPNSLEEVKEEYARMYSENDSVF LNSFLQDSPPEWFPSEAVGPDAEEEGEEEGEEEGEEGEEEEEGDEEGEEEEENGEEREVE EYQEEEEEEEEEEKKVDLSHSSSTLLPDLMEFERYLNFYKQTMDLLTMNSIISAHEVTLP IVSAAISHLWQTLSEEKKARLLQVWEQQHSAFADLTEACLELAGVEGSMKDSGVDSQGAS CSLESTPEEILFEDAFDVASFLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFK SLGCVNTPLNQEPEPPDDDDAMLLKCLETFDDL
Expression Region 1-393
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Stimulated by retinoic acid gene 8 protein(Stra8),E.coli
Code CSB-EP022873MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATPGEGNQPSDDGAPQPLAQLQKLEPRVVRRRLSQARHRATLVGLFNNLRKAVYSQSDI TASKWQVLNRTKIHIQEQEESLDKLLKLKASFNLQDGNPNSLEEVKEEYARMYSENDSVF LNSFLQDSPPEWFPSEAVGPDAEEEGEEEGEEEGEEGEEEEEGDEEGEEEEENGEEREVE EYQEEEEEEEEEEKKVDLSHSSSTLLPDLMEFERYLNFYKQTMDLLTMNSIISAHEVTLP IVSAAISHLWQTLSEEKKARLLQVWEQQHSAFADLTEACLELAGVEGSMKDSGVDSQGAS CSLESTPEEILFEDAFDVASFLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFK SLGCVNTPLNQEPEPPDDDDAMLLKCLETFDDL
Expression Region 1-393
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Stimulated by retinoic acid gene 8 protein(Stra8),Baculovirus
Code CSB-BP022873MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATPGEGNQPSDDGAPQPLAQLQKLEPRVVRRRLSQARHRATLVGLFNNLRKAVYSQSDI TASKWQVLNRTKIHIQEQEESLDKLLKLKASFNLQDGNPNSLEEVKEEYARMYSENDSVF LNSFLQDSPPEWFPSEAVGPDAEEEGEEEGEEEGEEGEEEEEGDEEGEEEEENGEEREVE EYQEEEEEEEEEEKKVDLSHSSSTLLPDLMEFERYLNFYKQTMDLLTMNSIISAHEVTLP IVSAAISHLWQTLSEEKKARLLQVWEQQHSAFADLTEACLELAGVEGSMKDSGVDSQGAS CSLESTPEEILFEDAFDVASFLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFK SLGCVNTPLNQEPEPPDDDDAMLLKCLETFDDL
Expression Region 1-393
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Stimulated by retinoic acid gene 8 protein(Stra8),Mammalian cell
Code CSB-MP022873MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MATPGEGNQPSDDGAPQPLAQLQKLEPRVVRRRLSQARHRATLVGLFNNLRKAVYSQSDI TASKWQVLNRTKIHIQEQEESLDKLLKLKASFNLQDGNPNSLEEVKEEYARMYSENDSVF LNSFLQDSPPEWFPSEAVGPDAEEEGEEEGEEEGEEGEEEEEGDEEGEEEEENGEEREVE EYQEEEEEEEEEEKKVDLSHSSSTLLPDLMEFERYLNFYKQTMDLLTMNSIISAHEVTLP IVSAAISHLWQTLSEEKKARLLQVWEQQHSAFADLTEACLELAGVEGSMKDSGVDSQGAS CSLESTPEEILFEDAFDVASFLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFK SLGCVNTPLNQEPEPPDDDDAMLLKCLETFDDL
Expression Region 1-393
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Stra8 ELISA Kit

Stra8 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.