Recombinant Mouse Surfeit locus protein 6(Surf6)

Product Type Recombinant Protein
Uniprot No. P70279
Species Mus musculus (Mouse)
Gene Names Surf6
Protein Names Recommended name: Surfeit locus protein 6
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.
Function Binds to both DNA and RNA in vitro, with a stronger binding capacity for RNA. May represent a nucleolar constitutive protein involved in ribosomal biosynthesis or assembly.
Subcellular Location Nucleus, nucleoplasm
Protein Families SURF6 family
Tissue Specificity Expressed in all tissues tested, including heart, brain, spleen, lung, liver, muscle, kidney and testis.
Database Links

KEGG: mmu:20935

STRING: 10090.ENSMUSP00000048457

UniGene: Mm.245577

Product Details for Different Expression Systems

Product Name Recombinant Mouse Surfeit locus protein 6(Surf6),Yeast
Code CSB-YP022966MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPKKKRKKTQKKSPEQEQ KAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGTARESVFALDFLRQRLH EKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAKQQVAEAEKKEEPVEVTP KMACKELQESGLIFNKVEVTEEEPASKAQRKKEKRQKVKGNLTPLTGRNYRQLLDRLQAR QGRLDELRDQDAAKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRRAQRQRK WEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQKAHKKGRVLPQDLERAGLS
Expression Region 1-355
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Surfeit locus protein 6(Surf6),E.coli
Code CSB-EP022966MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPKKKRKKTQKKSPEQEQ KAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGTARESVFALDFLRQRLH EKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAKQQVAEAEKKEEPVEVTP KMACKELQESGLIFNKVEVTEEEPASKAQRKKEKRQKVKGNLTPLTGRNYRQLLDRLQAR QGRLDELRDQDAAKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRRAQRQRK WEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQKAHKKGRVLPQDLERAGLS
Expression Region 1-355
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Surfeit locus protein 6(Surf6),Baculovirus
Code CSB-BP022966MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPKKKRKKTQKKSPEQEQ KAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGTARESVFALDFLRQRLH EKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAKQQVAEAEKKEEPVEVTP KMACKELQESGLIFNKVEVTEEEPASKAQRKKEKRQKVKGNLTPLTGRNYRQLLDRLQAR QGRLDELRDQDAAKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRRAQRQRK WEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQKAHKKGRVLPQDLERAGLS
Expression Region 1-355
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Surfeit locus protein 6(Surf6),Mammalian cell
Code CSB-MP022966MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MASLLAKDTYLQDLAKKICAQPGPERQRSTWGVRTKGSEAAGAPKKKRKKTQKKSPEQEQ KAMDHKTKALGKKPPTSSRPKNPMVSKQEKGLSSLGSPKDSQGTARESVFALDFLRQRLH EKIQLARGQGSTKELSAATLEKRQRRKQERERKKRKRKERQAKQQVAEAEKKEEPVEVTP KMACKELQESGLIFNKVEVTEEEPASKAQRKKEKRQKVKGNLTPLTGRNYRQLLDRLQAR QGRLDELRDQDAAKAQELEAKMKWTNLLYKAEGVKIRDDERLLQEALKRKEKRRAQRQRK WEKRSEHVVEKMQQRQDKRRQNLRKKKAARAERRLQKAHKKGRVLPQDLERAGLS
Expression Region 1-355
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.