Recombinant Mouse T-box transcription factor TBX3 (Tbx3)

Code CSB-YP023255MO
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023255MO
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023255MO-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023255MO
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023255MO
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Tbx3
Uniprot No.
Alternative Names
Tbx3; T-box transcription factor TBX3; T-box protein 3
Species
Mus musculus (Mouse)
Expression Region
1-741
Target Protein Sequence
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEDVEDDPKVHLEAKELWDQFHKRG TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA KGFRDTGNGRREKRKQLTLQSMRVFEERHKKETSDESSSEQAAFNCFAQASSPAVSIVGT SNLKDLCPSEAESDAEAESKEEHGPEACDAAKISTTTAEEPGRDKGSPATRAQLFPAEPS RARDTARLDKASPDSRHSPATISSSTRVPGADERRSPGREGPVATKVDEARAIPAKDAFA PLSVQTDATAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPGQFAMGGAFSSMAAGMGPL LATVSGASTGVSGLESTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSLFP YPYTYMAAAAAASTAAASSSVHRHPFLNLNSMRPRLRYSPYSIPVPVPDSSSLLATALPS MASAAGPLDGKAAALAASPASVAVDSGSELNSRSSTLSSGSVSLSPKLCSEKEAATSELQ SIQRLVSGLEAKPDRSCSGSP
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional repressor involved in developmental processes. Binds to the palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence, or a half-site, which are present in the regulatory region of several genes. Probably plays a role in limb pattern formation. Required for mammary placode induction, and maintenance of the mammary buds during development. Involved in branching morphogenesis in both developing lungs and adult mammary glands, via negative modulation of target genes; acting redundantly with TBX2. Required, together with TBX2, to maintain cell proliferation in the embryonic lung mesenchyme; perhaps acting downstream of SHH, BMP and TGFbeta signaling. Involved in modulating early inner ear development, acting independently of, and also redundantly with, TBX2 in different subregions of the developing ear. Acts as a negative regulator of PML function in cellular senescence.
Gene References into Functions
  1. Tbx3 is required for abdominal skin expansion in pregnant mice. PMID: 28894084
  2. TBX3 is not only required for development of posterior forelimb bones (ulna and digits 4 and 5), but also for a subset of posterior muscles (lateral triceps and brachialis) and their bone eminence attachment sites. PMID: 27491074
  3. Tbx3 functions upstream of Hes1 to regulate proliferation and differentiation of basal and suprabasal cells during epidermal development. PMID: 28205312
  4. T-box3 interacts with Kif7 and is required for normal stoichiometry and function of a Kif7/Sufu complex that regulates Gli3 stability and processing. PMID: 27046536
  5. Low TBX3 levels are associated with reduced pluripotency for embryonic stem cells, resembling the more mature epiblast. PMID: 26651606
  6. miR-93 controls Tbx3 expression, thereby limiting self-renewal in early adipocyte precursors. PMID: 26321631
  7. In-depth transcriptome analysis of this mESC state reveals Dppa3 as a direct downstream target of Tbx3.We show that Tbx3, a downstream target of Wnt signaling, fine tunes these divergent roles of Wnt signaling in mESCs PMID: 26095607
  8. Hoxc8 initiates an ectopic mammary program by regulating Fgf10 and Tbx3 expression and Wnt/beta-catenin signaling PMID: 26459221
  9. Tbx3 can activate Zscan4(+)/2C state by negative regulation of DNA methylation at repeated sequences, linking to telomere maintenance and self-renewal of ES cells. PMID: 24336466
  10. Tbx3 is important for the generation of hormone-sensing cells. PMID: 25343378
  11. Taken together, we define further facets of TBX3 actions and map TBX3 as an upstream regulator of the mesendoderm transcriptional program during gastrulation. PMID: 24319661
  12. The Tbx3 locus forms a CTCF-independent autonomous regulatory domain with multiple combinatorial regulatory elements that control the precise pattern of Tbx3 in the cardiac conduction system. PMID: 24963028
  13. Tbx3 plays an important role in osteoclastogenesis at least in part by regulating CSF1-dependent expression of JDP2. PMID: 24394418
  14. results not only reveal the essential roles of Tbx3 and Tbx3+2a in pluripotency maintaining, but also point out the different mechanistic modes between these two isoforms PMID: 24472544
  15. The effects of Tbx20 are epistatic to Tbx3 in the heart, but Tbx3 is epistatic to Tbx20 with respect to developmental delay. PMID: 23936153
  16. Data suggest that the possibility that mechanisms in addition to TBX3 haploinsufficiency may cause Ulnar-mammary syndrome (UMS) or other malformations merits investigation in the human UMS population. PMID: 23844108
  17. Jmjd3 sequentially associates with two T-box factors, Tbx3 and Eomes to drive stem cell differentiation towards the definitive endoderm lineage. PMID: 23584530
  18. Data indicate the role and regulation of T-box transcription factor TBX3 in limb development. PMID: 22535523
  19. TBX3 reprogrammes terminally differentiated working cardiomyocytes and induces important pacemaker properties. PMID: 22419669
  20. over-expression of TBX3 may contribute to breast cancer development by promoting accelerated mammary gland development through the inhibition of the NF-kappaB pathway and stimulation of both mammary epithelial cell and stem-like cell proliferation. PMID: 22039763
  21. Tbx3 is required for the functional development, maturation, and homeostasis of the conduction system in a highly dosage-sensitive manner. PMID: 22203979
  22. Tbx3 represses the Runx2-mediated stimulation of the osteopontin promoter. PMID: 21455926
  23. that Tbx3 may function through direct binding and epigenetic modification of histones on the Gata6 promoter to maintain the ExEn differentiation potential of ESCs. PMID: 21189255
  24. Tbx3 significantly improves the quality of iPS cells: iPS cells generated with OSK and Tbx3 are superior in both germ-cell contribution to the gonads and germ-line transmission frequency PMID: 20139965
  25. TBX3 is produced in three discrete neuronal populations of the adult mouse brain, the arcuate nucleus (including in NPY but not dopaminergic neurons), the histaminergic tuberomammillary nucleus and in cholinergic neurons of the solitary tract nucleus. PMID: 19765559
  26. Tbx3 impinges on the p53 pathway to suppress apoptosis, facilitate cell transformation and block myogenic differentiation PMID: 12032820
  27. Tbx3 expression in limb buds of mouse mutants in which anteroposterior patterning is abnormal PMID: 12376101
  28. the phenotype of Tbx3 mutant mice verifies the role of this gene in limb and mammary gland development, and reveals a previously unknown role for the gene in the yolk sac; first T-box gene implicated in yolk sac development PMID: 12668638
  29. Tbx3 and Bmp4 strongly up- and down-regulate each other in order to control the proliferation of the palatal shelf during secondary palate development. PMID: 17028893
  30. mutual interactions between Bmp4 and Tbx3 determine the presumptive dorsoventral boundary and formation of mammary glands in early embryogenesis PMID: 17071745
  31. Nyx2-5 confines TBX3 expression to the sinoatrial node & sinus horns. Tbx3 suppresses chamber differentiation, providing another mechanism by which the Tbx3-positive sinoatrial node is shielded from differentiating into atrial myocardium. PMID: 17234970
  32. This is the first direct evidence that the level of Tbx3 expression positively controls the proliferation of mammary epithelial cells via pathways alternative to Mdm2-p53. PMID: 17265068
  33. found lineage segregation of Tbx3-negative atrial and Tbx3-positive sinoatrial node precursor cells as soon as cardiac cells turn on the atrial gene expression program PMID: 17473172
  34. Tbx3 plays a crucial role in controlling hepatoblast proliferation and cell-fate determination by suppressing p19(ARF) expression and thereby promoting liver organogenesis. PMID: 18356246
  35. Splice variant Tbx3 + 2a is evolutionary conserved. The results suggest Tbx3 and Tbx3 + 2a are functionally equivalent and like Tbx2, Tbx3 may also function as an anti-senescence factor in melanoma. PMID: 18444963
  36. Tbx3 is required for the molecular specification of the atrioventricular bundle and bundle branches and for the development of the ventricular septum and outflow tract. PMID: 18467625
  37. Tbx3 is required for outflow tract development. PMID: 18723448
  38. Tbx18 controls the formation of the SAN head from mesenchymal precursors on which Tbx3 subsequently imposes the pacemaker gene program. PMID: 19096026
  39. Tbx3 overexpression abolished increased osterix and runx2 expression observed during normal osteoblast differentiation PMID: 19115250
  40. Tbx3 controls liver bud expansion by suppressing cholangiocyte and favoring hepatocyte differentiation in the liver bud. PMID: 19140222

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
In adults, highest levels in lung. Also found in brain, heart, kidney, liver and ovary.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X