Recombinant Mouse T-box transcription factor TBX4(Tbx4)

Product Type Recombinant Protein
Uniprot No. P70325
Species Mus musculus (Mouse)
Gene Names Tbx4
Protein Names Recommended name: T-box transcription factor TBX4 Short name= T-box protein 4
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mouse Tbx4, which is closely linked to Tbx2 on mouse chromosome 11. Similarly this gene, like TBX2, maps to human chromosome 17. Expression studies in mouse and chicken show that Tbx4 is expressed in developing hindlimb, but not in forelimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity.
HGNC 11603
RGD 1309057
MGI 102556
Function Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
Subcellular Location Nucleus
Database Links

KEGG: mmu:21387

STRING: 10090.ENSMUSP00000000096

UniGene: Mm.275336

Product Details for Different Expression Systems

Product Name Recombinant Mouse T-box transcription factor TBX4(Tbx4),Yeast
Code CSB-YP023256MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLQDKGLSESEEAFRAPGPALGEASNTSTTNAPEPALATPGLSGAALSSPPGQGADVAAA AAAAAEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYIL LIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTN NHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKI TQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLVSSQLSAKPDVSPLHS AHQALQHYQYENGAHMQFAAAEPQDLPLNTFPTQRDSSLFYHCLKRRDSARHLDLPCKRS YLETPSSVGDDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSSSGPEIAGVSAVDDLPPP PLSCNMWTSVSPYTSYSVQTMETVPYQPFPAHFTATTVMPRLPTIAAQSAQPPGNAHFSV YNQLSQSQVRERGPSASFPRERGLPGMCERKPPSPHLNTANEFLYSQSFSLTRESSLQYH SGMGTVENWTDG
Expression Region 1-552
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse T-box transcription factor TBX4(Tbx4),E.coli
Code CSB-EP023256MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLQDKGLSESEEAFRAPGPALGEASNTSTTNAPEPALATPGLSGAALSSPPGQGADVAAA AAAAAEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYIL LIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTN NHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKI TQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLVSSQLSAKPDVSPLHS AHQALQHYQYENGAHMQFAAAEPQDLPLNTFPTQRDSSLFYHCLKRRDSARHLDLPCKRS YLETPSSVGDDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSSSGPEIAGVSAVDDLPPP PLSCNMWTSVSPYTSYSVQTMETVPYQPFPAHFTATTVMPRLPTIAAQSAQPPGNAHFSV YNQLSQSQVRERGPSASFPRERGLPGMCERKPPSPHLNTANEFLYSQSFSLTRESSLQYH SGMGTVENWTDG
Expression Region 1-552
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse T-box transcription factor TBX4(Tbx4),Baculovirus
Code CSB-BP023256MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLQDKGLSESEEAFRAPGPALGEASNTSTTNAPEPALATPGLSGAALSSPPGQGADVAAA AAAAAEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYIL LIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTN NHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKI TQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLVSSQLSAKPDVSPLHS AHQALQHYQYENGAHMQFAAAEPQDLPLNTFPTQRDSSLFYHCLKRRDSARHLDLPCKRS YLETPSSVGDDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSSSGPEIAGVSAVDDLPPP PLSCNMWTSVSPYTSYSVQTMETVPYQPFPAHFTATTVMPRLPTIAAQSAQPPGNAHFSV YNQLSQSQVRERGPSASFPRERGLPGMCERKPPSPHLNTANEFLYSQSFSLTRESSLQYH SGMGTVENWTDG
Expression Region 1-552
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse T-box transcription factor TBX4(Tbx4),Mammalian cell
Code CSB-MP023256MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLQDKGLSESEEAFRAPGPALGEASNTSTTNAPEPALATPGLSGAALSSPPGQGADVAAA AAAAAEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYIL LIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTN NHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKI TQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLVSSQLSAKPDVSPLHS AHQALQHYQYENGAHMQFAAAEPQDLPLNTFPTQRDSSLFYHCLKRRDSARHLDLPCKRS YLETPSSVGDDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSSSGPEIAGVSAVDDLPPP PLSCNMWTSVSPYTSYSVQTMETVPYQPFPAHFTATTVMPRLPTIAAQSAQPPGNAHFSV YNQLSQSQVRERGPSASFPRERGLPGMCERKPPSPHLNTANEFLYSQSFSLTRESSLQYH SGMGTVENWTDG
Expression Region 1-552
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.