Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5)

Product Type Recombinant Protein
Uniprot No. P69744
Species Mus musculus (Mouse)
Gene Names Trpv5
Protein Names Recommended name: Transient receptor potential cation channel subfamily V member 5 Short name= TrpV5 Alternative name(s): Calcium transport protein 2 Short name= CaT2 Epithelial calcium channel 1 Short name= ECaC1 Osm-
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.
HGNC 3145
RGD 620636
MGI 2429764
Function Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine
Subcellular Location Apical cell membrane, Multi-pass membrane protein
Protein Families Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV5 sub-subfamily
Tissue Specificity Detected in kidney cortex (at protein level).
Database Links

KEGG: mmu:194352

STRING: 10090.ENSMUSP00000031901

UniGene: Mm.135734

Product Details for Different Expression Systems

Product Name Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5),Yeast
Code CSB-YP025097MO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGAKTPWIQLQKLLNWWVRDQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKKLQH DQNCDFRQRGALGETALHVAALYDNLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVM NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLA GVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSFLELVVSSKKKEARQI LEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTI MEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHV IIITYASLVLLTMAMRLTNVNGEVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIF GDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANY RVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGLDPGEGDGEEI YQF
Expression Region 1-723
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5),E.coli
Code CSB-EP025097MO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGAKTPWIQLQKLLNWWVRDQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKKLQH DQNCDFRQRGALGETALHVAALYDNLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVM NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLA GVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSFLELVVSSKKKEARQI LEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTI MEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHV IIITYASLVLLTMAMRLTNVNGEVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIF GDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANY RVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGLDPGEGDGEEI YQF
Expression Region 1-723
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5),Baculovirus
Code CSB-BP025097MO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGAKTPWIQLQKLLNWWVRDQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKKLQH DQNCDFRQRGALGETALHVAALYDNLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVM NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLA GVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSFLELVVSSKKKEARQI LEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTI MEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHV IIITYASLVLLTMAMRLTNVNGEVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIF GDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANY RVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGLDPGEGDGEEI YQF
Expression Region 1-723
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5),Mammalian cell
Code CSB-MP025097MO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MGAKTPWIQLQKLLNWWVRDQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKKLQH DQNCDFRQRGALGETALHVAALYDNLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVM NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLA GVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSFLELVVSSKKKEARQI LEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTI MEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHV IIITYASLVLLTMAMRLTNVNGEVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIF GDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANY RVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGLDPGEGDGEEI YQF
Expression Region 1-723
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.