Recombinant Mouse Transient receptor potential cation channel subfamily V member 5(Trpv5)

Code CSB-YP025097MO
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025097MO
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025097MO-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025097MO
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025097MO
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names Trpv5
Uniprot No. P69744
Alternative Names Trpv5; Transient receptor potential cation channel subfamily V member 5; TrpV5; Calcium transport protein 2; CaT2; Epithelial calcium channel 1; ECaC1; Osm-9-like TRP channel 3; OTRPC3
Species Mus musculus (Mouse)
Expression Region 1-723
Target Protein Sequence MGAKTPWIQLQKLLNWWVRDQDWNQHVDQLHMLQQKSIWESPLLRAAKENDMCTLKKLQH DQNCDFRQRGALGETALHVAALYDNLDAAIMLMEAAPYLVTESTLCEPFVGQTALHIAVM NQNVNLVRALLARGASASARATGSAFHRSSHNLIYYGEHPLSFAACVGSEEIVRLLIEHG ADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLA GVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDSWGEELSFLELVVSSKKKEARQI LEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTI MEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHV IIITYASLVLLTMAMRLTNVNGEVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIF GDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANY RVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERK MPRFLWPRSGICGCEYGLGDRWFLRVEHHQEQNPYRVLRYVEAFKSSDKEEVQEQLSEKQ PSGTETGTLARGSVVLQTPPLSRTTSLSSNSHRGWEILRRNTLGHLNLGLDPGEGDGEEI YQF
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine
Gene References into Functions
  1. life-long challenge of Ca2+ homeostasis present in Trpv5-/- mice causes accelerated bone aging and a low cortical and trabecular bone mass phenotype PMID: 27102152
  2. beta-gal is present in the pro-urine from where it is thought to stimulate TRPV5 activity. PMID: 26747426
  3. A novel primary cell model with TRPV5-dependent Ca(2+) transport characteristics was successfully established. PMID: 24557712
  4. Phosphorylation of beta1-AR by PKA stimulates active Ca(2+)influx through TRPV5. PMID: 24828496
  5. The expression of TRPV5 channel is regulated by estrogen via estrogen receptor in osteoblasts. PMID: 24150765
  6. Uromodulin upregulates TRPV5 by decreasing caveolin-1 dependent endocytosis of TRPV5. PMID: 23466996
  7. In colitis in mice, tumor necrosis factor and interferon-gamma reduced expression of Klotho, which otherwise would protect TRPV5 from hypersialylation and cytokine-induced TRPV5 endocytosis, UBR4-dependent ubiquitination, degradation, and Ca(2+) wasting. PMID: 23747339
  8. The TRPV5 S682P mutant is a functionally significant factor in autosomal dominant hypercalciuria. PMID: 23383183
  9. promoter driven Cre recombinase expression will be useful for inducing DCT2 and CNT specific gene silencing of various channels, pumps, carriers, and receptors PMID: 21290301
  10. Calcitonin augments the renal reabsorptive capacity for Ca(2+). This increase is likely to occur independently of TRPV5. PMID: 19965988
  11. TrpV5 mediates basal renal calcium absorption in null mutant mice lacking calcium channel beta3 subunits (CaVbeta3) and multimeric calcium channel entry via distal convoluted renal tubules. PMID: 19767875
  12. found in stria vascularis, organ of Corti, vestibular sensory cells and dark cells, and less intensely in the spiral and vestibular ganglion cells, in both old and young mice PMID: 19922080
  13. the key function of TRPV5 is in active Ca2+ reabsorption and it has an essential role in Ca2+ homeostasis PMID: 14679186
  14. demonstration of the significance of SGK1 and NHERF2 as TRPV5 modulators which are likely to participate in the regulation of calcium homeostasis by 1,25(OH)2D3 PMID: 15665527
  15. Hypervitaminosis D is of crucial importance to maintain normocalcemia in impaired Ca(2+) reabsorption in TRPV5 knockout mice. PMID: 16148038
  16. TRPV5 is stimulated by klotho; klotho hydrolyzes extracellular sugar residues on TRPV5, entrapping the channel in the plasma membrane PMID: 16239475
  17. These data demonstrated the important role of Rab11a in the trafficking of TRPV5 and TRPV6. PMID: 16354700
  18. binding site for NHERF4 localized in a conserved region in the carboxyl terminus of TRPV5 and was distinct from the binding site of the PDZ protein NHERF2. NHERF4 predominantly localized at the plasma membrane of X. PMID: 16565876
  19. downregulation of TRPV5 and TRPV6 is likely involved in the impaired Ca2+ (re)absorption during aging PMID: 16705151
  20. One aspect of vestibular dysfunction in Pendred syndrome is a pathological elevation of endolymphatic [Ca(2+)] due to luminal acidification and consequent inhibition of TRPV5/6-mediated Ca(2+) absorption. PMID: 17200157
  21. Unraveling molecular mechanisms of TRPV5 channel regulation by antiaging hormone klotho, tissue kallikrein & extracellular pH demonstrated existence of novel regulatory mechanisms of active calcium reabsorption acting from tubular lumen[review] PMID: 17565273
  22. Klotho participates in specific removal of alpha2,6-linked sialic acids and regulates cell surface retention of TRPV5 through this activity PMID: 18606998

Show More

Hide All

Subcellular Location Apical cell membrane, Multi-pass membrane protein
Protein Families Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV5 sub-subfamily
Tissue Specificity Detected in kidney cortex (at protein level).
Database Links

KEGG: mmu:194352

STRING: 10090.ENSMUSP00000031901

UniGene: Mm.135734

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1