Recombinant Mpuse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial

In Stock
Code CSB-YP004931MO
Size US$1593Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004931MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004931MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Cd3e
Uniprot No. P22646
Research Area Immunology
Alternative Names Alternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen: CD3e
Species Mus musculus (Mouse)
Source Yeast
Expression Region 23-108aa
Target Protein Sequence DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 11.9 kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

We are interested in item CSB-YP004931MO. For the current lot, would you please tell me the buffer before the product was lyophilized? What do you recommend for reconstitution?
Would you have this information available to share?

A:
Thanks for your email.
The stock of this protein has just run out. The new lot is already under production and we will rush the preparation.
1. This protein has been delivered in liquid form in the following two buffers before: 1) PBS, pH 7.4, 50% glycerol; 2) 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol.
2. If you would like Lyophilized Powder, we will add 6% trehalose to help dissolving later. The lead time will be extended for 3 working days. You can reconstitute the lyophilized protein directly with sterile deionized water. The general reconstitution method is as follows
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. You could use it as reference.
Any more questions, feel free to contact us. Nice day.
 Customer Reviews

Target Data

Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell developement
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:12501

STRING: 10090.ENSMUSP00000099896

UniGene: Mm.210361

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.