Recombinant Mpuse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial

In Stock
Code CSB-YP004931MO
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P22646
Lead Time 3-7 business days
Relevance The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Alternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen: CD3e
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Research Area Immunology
Source Yeast
Gene Names Cd3e
Protein Names Alternative name(s): T-cell surface antigen T3/Leu-4 epsilon chain CD_antigen: CD3e
Expression Region 23-108aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.9 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell developement
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:12501

STRING: 10090.ENSMUSP00000099896

UniGene: Mm.210361

Pathway Hematopoietic cell lineage
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Q&A and Customer Reviews

Q&A
Q:

We are interested in item CSB-YP004931MO. For the current lot, would you please tell me the buffer before the product was lyophilized? What do you recommend for reconstitution?
Would you have this information available to share?

A:
Thanks for your email.
The stock of this protein has just run out. The new lot is already under production and we will rush the preparation.
1. This protein has been delivered in liquid form in the following two buffers before: 1) PBS, pH 7.4, 50% glycerol; 2) 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol.
2. If you would like Lyophilized Powder, we will add 6% trehalose to help dissolving later. The lead time will be extended for 3 working days. You can reconstitute the lyophilized protein directly with sterile deionized water. The general reconstitution method is as follows
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. You could use it as reference.
Any more questions, feel free to contact us. Nice day.
Customer Reviews

Related Products

Cd3e Proteins

Cd3e Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.