Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

In Stock

Code CSB-BP358713MVZb0
Product Type Recombinant Protein
Size US$330Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P9WIN8
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Source Baculovirus
Gene Names mpt64
Protein Names Antigen MPT64
Expression Region 24-228aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 24.5 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Database Links

KEGG: mtc:MT2032

Related Products

mpt64 Antibodies

mpt64 Antibodies for Mycobacterium tuberculosis

mpt64 Antibodies for Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

mpt64 Proteins

mpt64 Proteins for Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.