Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4)

Product Type Recombinant Protein
Uniprot No. B0Y0P7
Species Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Gene Names uba4
Protein Names Recommended name: Adenylyltransferase and sulfurtransferase uba4 Alternative name(s): Common component for nitrate reductase and xanthine dehydrogenase protein F Ubiquitin-like protein activator 4 Including the following 2 domains: Mol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions (By similarity).
Subcellular Location Cytoplasm
Protein Families HesA/MoeB/ThiF family, UBA4 subfamily

Product Details for Different Expression Systems

Product Name Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4),Yeast
Code CSB-YP535250NGT
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREW PLLSEEYKRYGRQMIVPQLGLQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVD GDTVENSNLHRQVLHSSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHLTPQEAPGIFKDY DIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC VFPKPPPANSVVSCADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYS TPLFRTIRLRARRANCAVCSADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLE FKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSINIPISTILSSASSPTNVDAN AQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR AWREQIDPDWPEY
Expression Region 1-493
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4),E.coli
Code CSB-EP535250NGT
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREW PLLSEEYKRYGRQMIVPQLGLQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVD GDTVENSNLHRQVLHSSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHLTPQEAPGIFKDY DIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC VFPKPPPANSVVSCADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYS TPLFRTIRLRARRANCAVCSADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLE FKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSINIPISTILSSASSPTNVDAN AQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR AWREQIDPDWPEY
Expression Region 1-493
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4),Baculovirus
Code CSB-BP535250NGT
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREW PLLSEEYKRYGRQMIVPQLGLQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVD GDTVENSNLHRQVLHSSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHLTPQEAPGIFKDY DIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC VFPKPPPANSVVSCADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYS TPLFRTIRLRARRANCAVCSADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLE FKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSINIPISTILSSASSPTNVDAN AQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR AWREQIDPDWPEY
Expression Region 1-493
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4),Mammalian cell
Code CSB-MP535250NGT
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREW PLLSEEYKRYGRQMIVPQLGLQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVD GDTVENSNLHRQVLHSSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHLTPQEAPGIFKDY DIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC VFPKPPPANSVVSCADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYS TPLFRTIRLRARRANCAVCSADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLE FKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSINIPISTILSSASSPTNVDAN AQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR AWREQIDPDWPEY
Expression Region 1-493
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.