Recombinant Neosartorya fumigata Adenylyltransferase and sulfurtransferase uba4(uba4)

Code CSB-YP535250NGT
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP535250NGT
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP535250NGT-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP535250NGT
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP535250NGT
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names uba4
Uniprot No. B0Y0P7
Alternative Names uba4; cnxF; AFUB_058070; Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4) [Includes: Molybdopterin-synthase adenylyltransferase; EC 2.7.7.80; Adenylyltransferase uba4; Sulfur carrier protein MOCS2A adenylyltransferase); Molybdopterin-synthase sulfurtransferase; EC 2.8.1.11; Sulfur carrier protein MOCS2A sulfurtransferase; Sulfurtransferase uba4)]
Species Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Expression Region 1-493
Target Protein Sequence MENLEQTCASLRAQIAATEAQLAGLKRELEIAEQAAEVKAQSTTRTITAEDGKTNETREW PLLSEEYKRYGRQMIVPQLGLQGQLKLRAARVLIVGAGGLGCPAALYLAGAGVGTLGLVD GDTVENSNLHRQVLHSSKNVGTFKVDSAIEYLRELNPHPTYVPYRAHLTPQEAPGIFKDY DIVLDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNYPPRPVGDKSGGPCYRC VFPKPPPANSVVSCADGGILGPVVGTMGVLQALEAIKVITSPAVNPSASPPSLLIFSAYS TPLFRTIRLRARRANCAVCSADASVTLETLKNGSTDYVFFCGVAGLEATLSPEERISPLE FKKRHPKEVPQDGGRINKEPTIIDVREKVQFDICSLENSINIPISTILSSASSPTNVDAN AQPSLPFWLPRELASADSTDPIYVVCRHGNDSQIAVRRLKELGLDRGGQRYVGDIQGGLR AWREQIDPDWPEY
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers urm1 and mocs2a. Its N-terminus first activates urm1 and mocs2a as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to urm1 and mocs2a to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards urm1 and mocs2a. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; nfs1 probably acting as a sulfur donor for thiocarboxylation reactions (By similarity).
Subcellular Location Cytoplasm
Protein Families HesA/MoeB/ThiF family, UBA4 subfamily

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1