Recombinant Neosartorya fumigata Probable NAD(P)H-dependent D-xylose reductase xyl1

Product Type Recombinant Protein
Uniprot No. B0XNR0
Species Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Gene Names xyl1
Protein Names Recommended name: Probable NAD(P)H-dependent D-xylose reductase xyl1 Short name= XR EC= 1.1.1.307
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway (By similarity).
Protein Families Aldo/keto reductase family

Product Details for Different Expression Systems

Product Name Recombinant Neosartorya fumigata Probable NAD(P)H-dependent D-xylose reductase xyl1,Yeast
Code CSB-YP535239NGT
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTTPSIKLNSGYDMPLVGFGLWKVNKETCADQIYHAIKAGYRLFDGACDYGNEVEAGKGV ARAIQEGIVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGLDYFDLFIVHFPIALKYV DPAVRYPPGWLSENNKLEFSNASIQETWTAMESLVDKKLARSIGVSNFSAQLLMDLLRYA RIRPATLQIEHHPYLTQERLVTYAQKEGIAVTAYSSFGPLSFVELDLKDAHETPKLFDHD VIKGIAQKHGRTPAQVLLRWATQRNIAVIPKSNDPTRLAQNLDVTGWDLEASEIEAISAL NRNLRFNDPLAIPVV
Expression Region 1-315
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Probable NAD(P)H-dependent D-xylose reductase xyl1,E.coli
Code CSB-EP535239NGT
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTTPSIKLNSGYDMPLVGFGLWKVNKETCADQIYHAIKAGYRLFDGACDYGNEVEAGKGV ARAIQEGIVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGLDYFDLFIVHFPIALKYV DPAVRYPPGWLSENNKLEFSNASIQETWTAMESLVDKKLARSIGVSNFSAQLLMDLLRYA RIRPATLQIEHHPYLTQERLVTYAQKEGIAVTAYSSFGPLSFVELDLKDAHETPKLFDHD VIKGIAQKHGRTPAQVLLRWATQRNIAVIPKSNDPTRLAQNLDVTGWDLEASEIEAISAL NRNLRFNDPLAIPVV
Expression Region 1-315
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Probable NAD(P)H-dependent D-xylose reductase xyl1,Baculovirus
Code CSB-BP535239NGT
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTTPSIKLNSGYDMPLVGFGLWKVNKETCADQIYHAIKAGYRLFDGACDYGNEVEAGKGV ARAIQEGIVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGLDYFDLFIVHFPIALKYV DPAVRYPPGWLSENNKLEFSNASIQETWTAMESLVDKKLARSIGVSNFSAQLLMDLLRYA RIRPATLQIEHHPYLTQERLVTYAQKEGIAVTAYSSFGPLSFVELDLKDAHETPKLFDHD VIKGIAQKHGRTPAQVLLRWATQRNIAVIPKSNDPTRLAQNLDVTGWDLEASEIEAISAL NRNLRFNDPLAIPVV
Expression Region 1-315
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Neosartorya fumigata Probable NAD(P)H-dependent D-xylose reductase xyl1,Mammalian cell
Code CSB-MP535239NGT
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MTTPSIKLNSGYDMPLVGFGLWKVNKETCADQIYHAIKAGYRLFDGACDYGNEVEAGKGV ARAIQEGIVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGLDYFDLFIVHFPIALKYV DPAVRYPPGWLSENNKLEFSNASIQETWTAMESLVDKKLARSIGVSNFSAQLLMDLLRYA RIRPATLQIEHHPYLTQERLVTYAQKEGIAVTAYSSFGPLSFVELDLKDAHETPKLFDHD VIKGIAQKHGRTPAQVLLRWATQRNIAVIPKSNDPTRLAQNLDVTGWDLEASEIEAISAL NRNLRFNDPLAIPVV
Expression Region 1-315
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.