Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

Code CSB-YP309229OBG
Product Type Recombinant Protein
Size US$2959
Uniprot No. P86179
Relevance L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Oncorhynchus keta (Chum salmon) (Salmo keta)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD
Research Area others
Source Yeast
Protein Names Recommended name: L-rhamnose-binding lectin CSL3
Expression Region 1-195aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 24.0 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Related Products

Antibodies

Antibodies for Oncorhynchus keta (Chum salmon) (Salmo keta)

Proteins

Proteins for Oncorhynchus keta (Chum salmon) (Salmo keta)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.