Code | CSB-EP365970RID |
MSDS | |
Size | $388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Our Recombinant Rabies Virus Glycoprotein is a superior quality replication of the Glycoprotein from the Rabies virus (strain ERA). This protein, produced by the 'G' gene, plays a key role in the virus's life cycle, including viral entry and immune evasion. Our recombinant version is produced in E.coli and represents a partial sequence from the 20th to the 459th amino acid, making it a reliable choice for your related research endeavors.
Emphasizing quality and practicality, our Recombinant Rabies Virus Glycoprotein is N-terminal 6xHis-SUMO-tagged, allowing for an efficient purification and detection process. Rigorous testing has confirmed a purity level of over 90% as determined by SDS-PAGE. To cater to a variety of research needs, our product is available as a liquid or as a lyophilized powder, providing flexibility for your specific requirements.
There are currently no reviews for this product.
I would like to know your opinion about endotoxin and aseptic removal if we will be using the protein HPLC method ?
We are looking for Rabies G protein antigen or G+N protein antigen if available. You have several strains for Rabies G protein listed on your website. What was the antigen used to generate the antibody cat# CSB-PA14899A0Rb.
Please send me details for the antigen, expression systems, sizes offered, cost and lead time
KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY