Recombinant Rat 72 kDa type IV collagenase(Mmp2)

Code CSB-EP014666RA
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Mmp2
Uniprot No. P33436
Research Area Others
Alternative Names Mmp2; 72 kDa type IV collagenase; EC 3.4.24.24; 72 kDa gelatinase; Gelatinase A; Matrix metalloproteinase-2; MMP-2) [Cleaved into: PEX]
Species Rattus norvegicus (Rat)
Source E.coli
Expression Region 110-662aa
Target Protein Sequence YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 78.1kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues (By similarity).
Gene References into Functions
  1. MMP-2-activated near-infrared fluorescence signal correlates with the severity of intimal thickening in arteriovenous fistula created for hemodialysis access. PMID: 30061060
  2. Suggest roles for MMP2/9 in the morphological evolution of vasculature in surgical fl aps. PMID: 27902934
  3. MMP2 expression mediates the development of cyclophosphamide-induced cardiomyopathy. PMID: 29504102
  4. Data show that retinoic acid receptor alpha (RARalpha) improved the renal function and attenuated the progression of glomerulosclerosis (GS) that was associated with the over-expression of matrix metalloproteinases MMP2 and MMP9. PMID: 28645189
  5. Secretagogin-dependent MMP2 release from neurons regulates neuroblast migration. PMID: 28223495
  6. High MMP2 expression is associated with seizures. PMID: 28501723
  7. Studied effect of all-trans retinoic acid (ATRA) on matrix metalloproteinase 2 (MMP-2), and MMP-9 expression/ activity, and rat bone marrow-derived mesenchymal stem cell migration. MMP-2/-9 expression levels were higher in ATRA-treated MSCs; MMP-2/-9 activity was enhanced with increasing doses. Scratch test showed ATRA promoted cell migration of MSCs. PMID: 28488074
  8. immediate postnatal nutritional programming induces increases in circulating and aortic MMP-2 activity with parallel aortic wall alterations, such as decreased elastin integrity and enhanced thickening PMID: 26547079
  9. This study showed that in addition to the general reduction in placental and fetal growth during uteroplacental ischemia, localized angiogenic imbalance and diminished MMP-2 and MMP-9 could cause further decrease in placental and myoendometrial vascularization and placental and fetal growth in distal vs proximal uterus in hypertensive pregnant rats. PMID: 28912068
  10. Thus, similar to pharmaceutical ACE inhibitor captopril the dipeptide IW may effectively inhibit ACE activity and prevent the age and hypertension associated rise of aortic stiffness. PMID: 27239047
  11. Hyperglycemic animals showed an increased area of collagen fibers in the prostate, which was composed both types of collagens. MMP-2 activity was significantly reduced in the hyperglycemic animals, while MMP-9 activity was very low and showed no alteration. PMID: 28989027
  12. High MMP2 expression is associated with uraemic vascular calcifications. PMID: 26333546
  13. High mmp2 expression is associated with Retinitis Pigmentosa. PMID: 27893855
  14. MMP-2 mediates sarcomere degeneration in oncostatin M-induced cardiomyocyte dedifferentiation. PMID: 27199120
  15. conclusion, this study revealed a novel function of canstatin for inducing cell migration of adult rat cardiac fibroblasts at least in part by ERK phosphorylation through MMP-2 secretion, possibly via actin cytoskeletal change. PMID: 28003226
  16. The increase in nuclear MMP-2 activity seen during stunning injury here, indicates yet unknown biological actions, other than lamin proteolysis, which may require more severe ischemia to effect. PMID: 27079252
  17. The present study investigated rat models of Feeney's freefall-induced brain injury combined with Achilles tendon rupture-induced heterotopic ossification. It analyzed the altered curves of MMP-9, MMP-2 and tissue inhibitor of metalloproteinase-1 (TIMP-1) in addition to the curves of gene expression. PMID: 28259914
  18. indicated that fibulin3 may reduce the levels of MMP2 and 9 and oxidative stress in hypertensive vascular remodeling. PMID: 27035767
  19. a role of miR-29b-3p in vascular calcification involves targeting MMP2. PMID: 28164126
  20. the endothelium under ANGII stimulation acts as a novel and key activator of latent pro-MT1MMP and pro-MMP2 in smooth muscle cells of rat aorta PMID: 26598508
  21. the D/P Cr ratio was correlated with effluent levels of TN-C (rho = 0.57, p < 0.001) and MMP-2 (rho = 0.73, p < 0.001). We suggest that TN-C in the effluents may be a diagnostic marker for peritoneal deterioration with EMT-like change PMID: 26770971
  22. cardiomyocytes in 2D culture synthesize matrix metalloproteinases MMP-2 and MMP-9 PMID: 26567576
  23. Report cross-talk between macrophages, smooth muscle cells, and endothelial cells in response to cigarette smoke alters MMP2/9 levels. PMID: 26318311
  24. Nuclear factor kappaB inhibitor pyrrolidine dithiocarbamate modulates myocardial MMP-2 expression and ameliorates cardiac remodelling in renovascular hypertension. PMID: 25816715
  25. High phosphate/calcium induces vascular smooth muscle cell calcification and differentiation to an osteochondrogenic phenotype with an associated increase in MMP-2 expression. PMID: 25987498
  26. Angiotensin II regulates MMP-2, MMP-9, and TIMP-1 expression and affects collagen deposition. PMID: 25867313
  27. Rosiglitazone attenuates the increased MMP2/9 activity induced by cigarette smoke. PMID: 25897215
  28. High matrix Methaloproteinase 2 expression is associated with oral cancer. PMID: 25605162
  29. Ischemia/reperfusion-activated MMP-2 leads to the degradation of cardiac MLCK. PMID: 25451385
  30. MMP-2 degraded Titin fragment in serum is related to induction of skeletal muscle atrophy. PMID: 25077715
  31. The increased activationof MMP2 in spontaneously hypertensive rat may also lead to endothelial hypermeability, apoptosis and vascular rarefaction. PMID: 23481598
  32. Effects of maternal diabetes on male offspring: high cell proliferation and increased activity of MMP-2 in the ventral prostate. PMID: 24988912
  33. MMP2 seems to contribute to early brain elevation of IL-1beta after transient ischemia PMID: 25108165
  34. Our results, taken together, demonstrated that MMP-2 and MMP-9 were involved in the development of H2S-induced acute lung injury and dexamethaxone exerted protective effects by alleviating the expression of MMP-2 and MMP-9. PMID: 24722316
  35. MMP-2 may have a functionally significant role in the etiology of degenerative disc disease PMID: 23621950
  36. The data suggest that Matrix metalloproteinases, and more specifically MMP-2, influence the growth of developing afferent neurites in the mammalian inner ear in vivo. PMID: 24935409
  37. Results suggest that MMP-2 and MMP-9 may play a significant role in blood-brain barrier disruption after alcohol abuse. PMID: 24966898
  38. Aortic dissection is initiated by MMP-2 overexpression as a result of increased NA release from sympathetic nervous endings in response to Ang II. PMID: 24194850
  39. intracellular inhibition of MMP-2 in cardiomyocytes increases contractility of aerobically perfused myocytes PMID: 24769238
  40. these results described a novel mechanism in atherosclerosis through PDGF-BB signaling in VSMC, in which MMP-2 expression is induced via extracellular signal-regulated kinases and p38 mitogen-activated protein kinase phosphorylation, as well as ROCK PMID: 24792035
  41. Brain MMMP-2 activity levels are increased following withdrawal from self-administered cocaine. PMID: 25326689
  42. MMP-2 -1306 C/T was shown to be involved in the pathogenesis of prostate cancer in a Turkish population. PMID: 25539555
  43. Demonstrate that ANGII regulates pro-MMP-2 protein expression via cell-specific pathways in rat aorta. PMID: 24907869
  44. In a rat mammary neoplasm model matrix metalloproteinase 2 localization, was localized to cancer cells and fibroblasts than in the stroma. PMID: 25343559
  45. The levels of active MMP-2 are downregulated in peripheral nerve during diabetes and with treatment withminocycline. PMID: 25158309
  46. The location of Mmp2 and activity can be detected by means of in situ zymography and confocal microcopy, and this methodology may provide a useful tool in studies on the role of gelatinases in tooth development, maturation and in pathological conditions. PMID: 22897943
  47. LA modulated increased MMP-2 and MMP-9 activities and decreased TIMP-1 and TIMP-2 levels during renal I-R. PMID: 24160412
  48. This study demonistrated that mmp2 throughout hippocampus at all ages but expression levels were highest during the first postnatal week. PMID: 24114974
  49. I/R injury in steatotic livers resulted in significant increases in expression of YKL-40 (9 fold), and activation of MMP-2 (15 fold)/MMP-9 (12 fold). PMID: 24380732
  50. Data indicate that mechanical stretch induces MMP-2 production in vascular smooth muscle cells (VSMC) via activation of Akt pathway, that is mediated by activation of PDGFR-beta signaling pathways. PMID: 23950935
  51. LLLT accelerated tendon repair by promoting the synthesis of collagen, which is responsible for the mechanical properties of the tissue, and by modulating the activities of MMP-2 and MMP-9. PMID: 23179310
  52. Mitochonria associated membrane-localized MMP-2 could therefore potentially impact mitochondrial function by affecting endoplasmic reticulum-mitochondrial Ca(2+) signaling via its proteolysis of calreticulin. PMID: 24375642
  53. RT induced higher muscle MMP-2 activity in the left ventricle. PMID: 23790633
  54. MMP-2 and MMP-9 activation seems to be a major step in blood-brain barrier dysfunction. PMID: 23479197
  55. EMMPRIN/CD147-regulated MMP-2 and MMP-14, associated with low MMP-3, appear as the main characteristics of extracellular matrix remodeling in early overused tendons. PMID: 23404084
  56. In tenocytes from aging animals, mRNAs encoding MMP-2 (and MMP-9) were significantly more abundant compared to younger animals. PMID: 23281803
  57. Enhanced anticancer activity of nanopreparation containing an MMP2-sensitive PEG-drug conjugate and cell-penetrating moiety. PMID: 24062440
  58. This study suggests that in the pathogenesis of diabetic retinopathy activation of gelatinase MMPs (MMP-9 and MMP-2) is an early event. PMID: 23891690
  59. Insulin treatment inhibits MMP-2 and MMP-9 activity and gene expression 4 days after arterial injury. PMID: 23988659
  60. Hormone replacement therapy modulation of MMP-2/MMP-9 pathway may be a negative risk factor for exaggerated vascular response to injury. PMID: 23088810
  61. The results of this study showed that constant mechanical stretching of rat retinal Muller cells for 24 h led to a significant increase in the intracellular matrix metalloproteinase-2 mRNA and protein levels PMID: 23399998
  62. In its proliferative stage, the expression of MMP-2 remained high in the neutrophils and type II alveolocytes, by reducing in the macrophages, endothelium, and fibroblasts. PMID: 23383440
  63. Retinoic acid had a protective effect on hyperoxia-induced lung injury by down-regulating the expression of MMP-2 through decreasing the JNK and p38 activation in hyperoxia. PMID: 21505995
  64. Both electrical stimulation and stretching increase MMP-2 gene expression in rat denervated muscle, suggesting extracellular matrix remodeling. PMID: 19660200
  65. the possible role of PKG in the suppression of MMP-2. PMID: 22618526
  66. MMP-2 may play a novel role in myonuclear functions. PMID: 22419075
  67. 2,3,4',5-tetrahydroxystilbene-2-0-beta-D glucoside is involved in regulating the expressions of MMP-2 and MMP-9, and inhibiting inflammation. PMID: 21186625
  68. High MMP2 is associated with glomerulosclerosis in diabetic nephropathy. PMID: 21414971
  69. Data suggest that Mmp2 is induced in myometrium during pregnancy (alongside reduced myometrium contraction); Mmp2 is induced in myometrium by prolonged stretch or by estradiol and/or progesterone (alongside reduced myometrium contraction). PMID: 22496348
  70. Calcium-sensing receptor mediates oxidized low-density lipoprotein-induced MMP-2 production in vascular smooth muscle cells via PI3K/Akt signal pathway. PMID: 22083546
  71. the myofibroblast phenotype, characterized by the expression of high levels of contractile proteins, suppresses the expression of the pro-migratory gene, MMP-2 PMID: 22449415
  72. We found increased aortic collagen and elastin content in the early phase of hypertension, which were associated with vascular hypertrophy, increased vascular MMP-2 and MMP-14 (but not TIMP-2) levels, and increased gelatinolytic activity. PMID: 22342460
  73. It appears active form expression of MMP(-2) is modulated by exercise intensity PMID: 22095325
  74. Mutant IDH2-induced HIF-1alpha improved the secretion levels of pro-MMP-2 and pro-MMP-9 as well as the conversion from pro-MMP-2 to its active form, giving C6 glioma cells a higher migration potential. PMID: 22105553
  75. Data suggest that MMP-2/proMMP-2 are over-expressed in placenta (and increased in sera) in pregnancy in diabetic animals; expression of MMP-2/proMMP-2 can be down-regulated by dietary factors (i.e., administration of olive oil or safflower oil). PMID: 22098918
  76. Elevated interstitial MMP-2 levels are found in ischemic subcortical tissue after 2 h of middle cerebral artery occlusion. PMID: 22378877
  77. MMP-2, preactivated in the anteroventral cochlear nucleus to prepare for reinnervation, is functionally attributable to a compensatory reorganization of the deafferented neuronal network that includes axonal sprouting and synaptogenesis. PMID: 22135757
  78. Matrix metalloproteinase 2 induces epithelial-mesenchymal transition in prox-imal tubules from the luminal side and progresses fibrosis in mineralo-corticoid/salt-induced hypertensive rats. PMID: 22045122
  79. Inhibition of MMP activity in organs of Corti incubated with an MMP inhibitor in organotypic cultures resulted in hair cell death-suggesting that a basal level of MMP activity is required for hair cell survival. PMID: 21354273
  80. These results suggest that mutated LPA(1) may involve in the enhancement of Mmp-2 expression and activation in rat neuroblastoma cells. PMID: 22197817
  81. Shenlong Decoction may inhibit the expression of MMP-2 mRNA by up-regulating the expression of TIMP-1 mRNA so as to slow the progression of pulmonary fibrosis. PMID: 20939987
  82. MMP 2 and 9 activation is essential for coronary collateral growth (CCG) and is mediated, in part, by p38 MAPK. PMID: 21884701
  83. MMP-2 localizes to titin at the Z-disk region of the cardiac sarcomere and contributes to titin degradation in myocardial ischemia/reperfusion injury. PMID: 21041693
  84. MMP-2 and -9 mRNA expression and activity was reduced in ovariectomized rats. Diosgenin treatment increased MMP-2 expression but lowered MMP-9 expression. PMID: 21814480
  85. Results suggest a novel regulatory role of doxycycline on MMP-2 activity in addition to inhibitory action on MMP-9 and MMP-3 during prevention of gastric ulcers. PMID: 21876619
  86. In vitro degradation of human recombinant MLC1 by MMP-2 increased after ONOO(-) exposure of MLC1 in a concentration-dependent manner PMID: 20518849
  87. ANG II stimulates directly and indirectly (via sympathostimulator pathway) the MMP-2 expression but seems unable to affect MMP-9 expression through direct pathway PMID: 21952436
  88. Panax notoginsenoside inhibits expression of TNFa and MMP-2, enhancing left ventricular systolic and diastolic functions, decreasing peripheral resistance, and improving cardiac function of rats with post-myocardial infarction left ventricular remodeling. PMID: 19861263
  89. HGF attenuates TGF-beta1-induced fibrogenic responses in Achilles tendon, which was mediated by MMP-2. PMID: 21165643
  90. unlike in tooth development, matrix metallopeptidase 2 does not play a direct role the remodeling matrix in tooth eruption in adult rats PMID: 21308405
  91. Fluid shear stress in the tumor microenvironment may explain reduced glioma invasion through modulation of cell motility and MMP levels. PMID: 21637818
  92. Interleukin-lbeta induces migration of rat arterial smooth muscle cells through a mechanism involving increased matrix metalloproteinase-2 activity. PMID: 20371087
  93. Streptozotocin induced diabetes led to increased LV/bodyweight, increased collagen content, and diminished MMP-2 with no change in PCr/ATP in rats; remodeling rather than disturbed energetics may underlie diabetic cardiomyopathy. PMID: 21882490
  94. Ovariectomy and resistance exercise modulate MMP-2 activity according to specific tendon region, indicating a differentiated tissue remodeling. PMID: 20388014
  95. Our results support the idea that the effects of doxycycline on MMP-2 and vascular structure are pressure independent. PMID: 21176109
  96. Our study suggests a complex regulation of MMP2 expression by oligomeric Abeta in astrocytes PMID: 21376707
  97. medial layer vascular calcification was observed in uremic rats and elastin degradation is likely accompanied by MMP-2 expression in the calcified area PMID: 21595847
  98. Data show that enhanced cell surface MT1-MMP in response to leptin resulted in enhanced extracellular activation of pro-MMP-2, which was attenuated by inhibition of Rho or ROCK. PMID: 21385940
  99. Unbalanced MMP/TIMP-1 expression and excessive gelatinolytic activity contribute to paraquat-induced pulmonary fibrosis. PMID: 21468558
  100. Specific MMP-2 blockade prevents sympathetic nerve sprouting (SNS) by inhibition of pro-NGF conversion. PMID: 20683769

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix, Membrane, Nucleus
Protein Families Peptidase M10A family
Database Links

KEGG: rno:81686

STRING: 10116.ENSRNOP00000022679

UniGene: Rn.6422

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1