Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

Code CSB-EP002572RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P97876
Relevance AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Jun dimerization protein 1 ;JDP-1
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV
Research Area Others
Source E.coli
Gene Names Batf3
Expression Region 1-133aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity).
Subcellular Location Nucleus
Protein Families BZIP family
Tissue Specificity Ubiquitously expressed.
Database Links

KEGG: rno:60462

STRING: 10116.ENSRNOP00000004962

UniGene: Rn.211982

Related Products

Batf3 Antibodies

Batf3 Antibodies for Rattus norvegicus (Rat)

Batf3 Proteins

Batf3 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.