Recombinant Rat Neogenin(Neo1),partial

Code CSB-YP015712RA
Product Type Recombinant Protein
Size US$2959
Uniprot No. P97603
Relevance Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence CTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHHERLELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQQSVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPIYDPALPSTPLLSQQALNHHLHSVKTASIGTLGRSRPPMPVVVPSAPEVQEATRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
Research Area Neuroscience
Source Yeast
Gene Names Neo1
Protein Names Ngn
Expression Region 1096-1377aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 33.0 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, DCC family
Database Links

UniGene: Rn.10667

Related Products

Neo1 Proteins

Neo1 Proteins for Rattus norvegicus (Rat)

Neo1 ELISA Kit

Neo1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.