Recombinant Rat Serpin B5(Serpinb5)

Product Type Recombinant Protein
Uniprot No. P70564
Species Rattus norvegicus (Rat)
Gene Names Serpinb5
Protein Names Recommended name: Serpin B5 Alternative name(s): Maspin Peptidase inhibitor 5 Short name= PI-5
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity (By similarity).
Subcellular Location Secreted, extracellular space
Protein Families Serpin family, Ov-serpin subfamily
Database Links

KEGG: rno:116589

STRING: 10116.ENSRNOP00000003625

UniGene: Rn.25752

Pathway p53 signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Rat Serpin B5(Serpinb5),Yeast
Code CSB-YP021073RA
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDALRLANSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHF ENVKDVPFGFKPITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVD FKDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFKADHPFLFIVRH NKTRNIVFLGKFSSP
Expression Region 1-375
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Serpin B5(Serpinb5),E.coli
Code CSB-EP021073RA
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDALRLANSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHF ENVKDVPFGFKPITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVD FKDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFKADHPFLFIVRH NKTRNIVFLGKFSSP
Expression Region 1-375
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Serpin B5(Serpinb5),Baculovirus
Code CSB-BP021073RA
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDALRLANSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHF ENVKDVPFGFKPITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVD FKDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFKADHPFLFIVRH NKTRNIVFLGKFSSP
Expression Region 1-375
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Serpin B5(Serpinb5),Mammalian cell
Code CSB-MP021073RA
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDALRLANSAFAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQVLHF ENVKDVPFGFKPITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVD FKDKLEETKGQINSSIKELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRINKTDTKPVQMMNLEATFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEKQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSVSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFKADHPFLFIVRH NKTRNIVFLGKFSSP
Expression Region 1-375
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Serpinb5 ELISA Kit

Serpinb5 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.