Recombinant Rat TGF-beta receptor type-1 (Tgfbr1), partial

Code CSB-YP023451RA
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023451RA
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023451RA-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023451RA
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023451RA
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Tgfbr1
Uniprot No.
Alternative Names
Tgfbr1; TGF-beta receptor type-1; TGFR-1; EC 2.7.11.30; Serine/threonine-protein kinase receptor R4; SKR4; TGF-beta type I receptor; Transforming growth factor-beta receptor type I; TGF-beta receptor type I; TbetaR-I
Species
Rattus norvegicus (Rat)
Expression Region
30-124
Target Protein Sequence
LQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTG AVTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVEL
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.
Gene References into Functions
  1. a novel role for SREBP-1 as a cell surface retention factor for TbetaRI in mesangial cells, is reported. PMID: 27826032
  2. This study demonstrated that Transcutaneous auricular vagus nerve stimulation regulates expression of growth differentiation factor 11 and activin-like kinase 5 in cerebral ischemia/reperfusion rats. PMID: 27653860
  3. miR-22 acts as a novel negative regulator of angiotensin II-induced cardiac fibrosis by suppressing the expression of TGFbetaRI in the heart. PMID: 27997889
  4. The expressions of TGF-beta 1, TbetaRI, and TbetaRII in LPD and LPD + KA groups were significantly lower than those in NPD group and lower in LPD + KA group than those in LPD group PMID: 26788514
  5. Renal fibrosis resulting from excessive accumulation of extracellular matrix mainly driven by TGF-beta1 is dependent on the regulation of transforming growth factor receptor 1 expression by let-7b. PMID: 24088962
  6. cocaine self-administration resulted in an increase in TGF-beta R1 protein expression PMID: 24386286
  7. Despite long-term obstruction injury, inhibition of TGF-betaRII and ALK5 core fucosylation ameliorated the progression of renal fibrosis, an effect independent of TGF-betaRII and ALK5 expression. PMID: 23486519
  8. inhibiting ALK5 signaling in vitro antagonized the TGFbeta1-induced increase in astrocyte generation and antagonizing ALK5 signaling in vivo similarly inhibited astrogliogenesis within the SVZ during recovery from hypoxia-ischemia injury PMID: 20221422
  9. These findings suggest that TGF-beta signaling via ALK5 plays a critical role in maintaining heart valve integrity. PMID: 21859884
  10. TGF-beta1 caused apoptosis of pulmonary microvascular endothelial cell, an effect that was also dependent on ALK5 activity. PMID: 19270180
  11. These results suggest that AT1 inhibition in the developing kidney impairs renal growth and development and modulates the expression of ALK-5 and TbetaRII. PMID: 16897002
  12. Differential expression of TGF-beta type I and II receptors by pulmonary cells in bleomycin-induced lung injury correlate with repair and fibrosis, with reduced Tgfbr1 expression occurring during the early (days 4-7) stage of increased cell proliferation. PMID: 11936776
  13. results reveal that estrogen may directly modulate expression of transforming growth factor receptor type I mRNA in the hypothalamus PMID: 12097811
  14. Tgfbr1 had a marked yet transient upregulation in glomerular cells in experimental glomerulonephritis. PMID: 12545247
  15. TGF-beta type I receptor expression is suppressed by differentiated osteoblasts , when exposed to TGF-beta. PMID: 16806744
  16. Renal expression of mRNA is lower after tacroimus than in cyclosporine administration. PMID: 16980036
  17. Transforming growth factor beta receptor 1 were obviously expressed in primitive pulmonary alveolus, showing it plays an important regulatory role in the development of rat embryo and embryonic lung, especially in organic morphodifferentiation. PMID: 17428384
  18. These results indicate that high plasma cholesterol levels may contribute to the pathogenesis of certain diseases (e.g., atherosclerosis) by suppressing TGF-beta responsiveness. PMID: 17972267
  19. Early MMP-9 activation precedes the increase of TGF-beta signaling, and overt vascular elastocalcinosis and stiffness. PMID: 18292396
  20. The roles played by the ecto/transmembrane (ecto/TM) domains and endodomains of RI and RII TGF-beta receptors in these processes by transfecting 293 or HeLa cells with different combinations of receptor mutants, was analysed. PMID: 18598696
  21. Inhibition of TGF-beta signaling via activin receptor-like kinase-5 prevents development and progression of pulmonary hypertension in the monocrotaline model and may involve inhibition of pulmonary artery smooth muscle cell migration PMID: 19153267

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, tight junction. Membrane raft. Cell surface.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Tissue Specificity
Urogenital ridge, testis, ovary, brain and lungs.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1