Recombinant Rat Tropomodulin-2(Tmod2)

Product Type Recombinant Protein
Uniprot No. P70566
Species Rattus norvegicus (Rat)
Gene Names Tmod2
Protein Names Recommended name: Tropomodulin-2 Alternative name(s): Neuronal tropomodulin Short name= N-Tmod
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
Function Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton (By similarity).
Subcellular Location Cytoplasm, cytoskeleton
Protein Families Tropomodulin family
Tissue Specificity Neuronal-tissue specific.
Database Links

KEGG: rno:58814

STRING: 10116.ENSRNOP00000014124

UniGene: Rn.74047

Product Details for Different Expression Systems

Product Name Recombinant Rat Tropomodulin-2(Tmod2),Yeast
Code CSB-YP023910RA
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
Expression Region 1-351
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Tropomodulin-2(Tmod2),E.coli
Code CSB-EP023910RA
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
Expression Region 1-351
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Tropomodulin-2(Tmod2),Baculovirus
Code CSB-BP023910RA
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
Expression Region 1-351
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rat Tropomodulin-2(Tmod2),Mammalian cell
Code CSB-MP023910RA
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
Expression Region 1-351
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.