Recombinant Rat Acetyl-CoA carboxylase 1(Acaca),partial

Code CSB-YP001119RA
Product Type Recombinant Protein
Size US$2959
Uniprot No. P11497
Relevance Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias ACC-alphaIncluding the following 1 domains:Biotin carboxylase (EC:6.3.4.14)
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA
Research Area Cancer
Source Yeast
Gene Names Acaca
Protein Names Recommended name: Acetyl-CoA carboxylase 1 Short name= ACC1 EC= 6.4.1.2Alternative name(s): ACC-alpha Including the following 1 domains: Biotin carboxylase EC= 6.3.4.14
Expression Region 116-617aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 57.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions
Subcellular Location Cytoplasm
Database Links

KEGG: rno:60581

STRING: 10116.ENSRNOP00000049438

UniGene: Rn.163753

Pathway AMPK signaling
Glucagon signaling pathway
Insulin signaling pathway
Myocardial Fatty Acid Metabolism

Related Products

Acaca Antibodies

Acaca Antibodies for Rattus norvegicus (Rat)

Acaca Proteins

Acaca Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.