Recombinant Rhodococcus sp. Anthranilate phosphoribosyltransferase(trpD)

Product Type Recombinant Protein
Uniprot No. Q0SHN1
Abbreviation trpD
Species Rhodococcus jostii (strain RHA1)
Gene Names trpD
Protein Names Recommended name: Anthranilate phosphoribosyltransferase EC= 2.4.2.18
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the transfer of the phosphoribosyl group of 5-phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA).
Protein Families Anthranilate phosphoribosyltransferase family
Database Links

KEGG: rha:RHA1_ro01128

STRING: 101510.RHA1_ro01128

Product Details for Different Expression Systems

Product Name Recombinant Rhodococcus sp. Anthranilate phosphoribosyltransferase(trpD),Yeast
Code CSB-YP603996RLO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQSPTAQGTNDGVRPARTWPSVLGTLTDGRDLSVDEAKWAMDEIMSDNATSAQIAAFGVA LKMKGETPEELRGLADSMLGHARKVPVDDDVVDIVGTGGDRSNTVNISTMASLVVAASGI RVVKHGNRAASSKSGGADVLEALGVKINLGPDEVARCVREVGIGFCFAPVFHPALRFAGA PRKEIGIPTVFNVLGPLTNPARPRAGLIGCAFPGLISVVAGVLAQRGNSALVVRGDDGLD ELTTSTTSTVHIVADGAVTTRQLDPRDIGIARVSLDELRGGDAEVNAAVARRLFAGETGP VRDAVLLNAAAAIAAFRGLGGRTLEDALSDGLSTAAQSIDSGAAATLLARWAELTSGLAT SK
Expression Region 1-362
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rhodococcus sp. Anthranilate phosphoribosyltransferase(trpD),E.coli
Code CSB-EP603996RLO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQSPTAQGTNDGVRPARTWPSVLGTLTDGRDLSVDEAKWAMDEIMSDNATSAQIAAFGVA LKMKGETPEELRGLADSMLGHARKVPVDDDVVDIVGTGGDRSNTVNISTMASLVVAASGI RVVKHGNRAASSKSGGADVLEALGVKINLGPDEVARCVREVGIGFCFAPVFHPALRFAGA PRKEIGIPTVFNVLGPLTNPARPRAGLIGCAFPGLISVVAGVLAQRGNSALVVRGDDGLD ELTTSTTSTVHIVADGAVTTRQLDPRDIGIARVSLDELRGGDAEVNAAVARRLFAGETGP VRDAVLLNAAAAIAAFRGLGGRTLEDALSDGLSTAAQSIDSGAAATLLARWAELTSGLAT SK
Expression Region 1-362
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rhodococcus sp. Anthranilate phosphoribosyltransferase(trpD),Baculovirus
Code CSB-BP603996RLO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQSPTAQGTNDGVRPARTWPSVLGTLTDGRDLSVDEAKWAMDEIMSDNATSAQIAAFGVA LKMKGETPEELRGLADSMLGHARKVPVDDDVVDIVGTGGDRSNTVNISTMASLVVAASGI RVVKHGNRAASSKSGGADVLEALGVKINLGPDEVARCVREVGIGFCFAPVFHPALRFAGA PRKEIGIPTVFNVLGPLTNPARPRAGLIGCAFPGLISVVAGVLAQRGNSALVVRGDDGLD ELTTSTTSTVHIVADGAVTTRQLDPRDIGIARVSLDELRGGDAEVNAAVARRLFAGETGP VRDAVLLNAAAAIAAFRGLGGRTLEDALSDGLSTAAQSIDSGAAATLLARWAELTSGLAT SK
Expression Region 1-362
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Rhodococcus sp. Anthranilate phosphoribosyltransferase(trpD),Mammalian cell
Code CSB-MP603996RLO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQSPTAQGTNDGVRPARTWPSVLGTLTDGRDLSVDEAKWAMDEIMSDNATSAQIAAFGVA LKMKGETPEELRGLADSMLGHARKVPVDDDVVDIVGTGGDRSNTVNISTMASLVVAASGI RVVKHGNRAASSKSGGADVLEALGVKINLGPDEVARCVREVGIGFCFAPVFHPALRFAGA PRKEIGIPTVFNVLGPLTNPARPRAGLIGCAFPGLISVVAGVLAQRGNSALVVRGDDGLD ELTTSTTSTVHIVADGAVTTRQLDPRDIGIARVSLDELRGGDAEVNAAVARRLFAGETGP VRDAVLLNAAAAIAAFRGLGGRTLEDALSDGLSTAAQSIDSGAAATLLARWAELTSGLAT SK
Expression Region 1-362
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.