Recombinant Shewanella piezotolerans Nucleoid occlusion factor SlmA(slmA)

Product Type Recombinant Protein
Uniprot No. B8CM26
Species Shewanella piezotolerans (strain WP3 / JCM 13877)
Gene Names slmA
Protein Names Recommended name: Nucleoid occlusion factor SlmA
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Required for nucleoid occlusion (NO) phenomenon, which prevents Z-ring formation and cell division over the nucleoid. Acts as a DNA-associated cell division inhibitor that binds simultaneously chromosomal DNA and FtsZ, and disrupts the assembly of FtsZ polymers. SlmA-DNA-binding sequences (SBS) are dispersed on non-Ter regions of the chromosome, preventing FtsZ polymerization at these regions.
Subcellular Location Cytoplasm, nucleoid
Protein Families Nucleoid occlusion factor SlmA family
Database Links

KEGG: swp:swp_2200

STRING: 225849.swp_2200

Product Details for Different Expression Systems

Product Name Recombinant Shewanella piezotolerans Nucleoid occlusion factor SlmA(slmA),Yeast
Code CSB-YP490257SYW
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAALYRHFPSKARMFEGLI EFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISRVLNGDALLGENERLRS RISQLFSKIETHLKQILREKSLREGQAFSIDEAVLANLLMAIAEGRIAQFVRSEFKLKPT KHFNEQWTFVQQQLLQS
Expression Region 1-197
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans Nucleoid occlusion factor SlmA(slmA),E.coli
Code CSB-EP490257SYW
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAALYRHFPSKARMFEGLI EFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISRVLNGDALLGENERLRS RISQLFSKIETHLKQILREKSLREGQAFSIDEAVLANLLMAIAEGRIAQFVRSEFKLKPT KHFNEQWTFVQQQLLQS
Expression Region 1-197
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans Nucleoid occlusion factor SlmA(slmA),Baculovirus
Code CSB-BP490257SYW
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAALYRHFPSKARMFEGLI EFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISRVLNGDALLGENERLRS RISQLFSKIETHLKQILREKSLREGQAFSIDEAVLANLLMAIAEGRIAQFVRSEFKLKPT KHFNEQWTFVQQQLLQS
Expression Region 1-197
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella piezotolerans Nucleoid occlusion factor SlmA(slmA),Mammalian cell
Code CSB-MP490257SYW
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAALYRHFPSKARMFEGLI EFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISRVLNGDALLGENERLRS RISQLFSKIETHLKQILREKSLREGQAFSIDEAVLANLLMAIAEGRIAQFVRSEFKLKPT KHFNEQWTFVQQQLLQS
Expression Region 1-197
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.