Recombinant Shewanella sp. Probable chorismate--pyruvate lyase(ubiC)

Product Type Recombinant Protein
Uniprot No. Q0HP10
Abbreviation ubiC
Species Shewanella sp. (strain MR-4)
Gene Names ubiC
Protein Names Recommended name: Probable chorismate--pyruvate lyase Short name= CL Short name= CPL EC= 4.1.3.40
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate (4HB) for the ubiquinone pathway.
Subcellular Location Cytoplasm
Protein Families UbiC family
Database Links

KEGG: she:Shewmr4_0126

Product Details for Different Expression Systems

Product Name Recombinant Shewanella sp. Probable chorismate--pyruvate lyase(ubiC),Yeast
Code CSB-YP603644
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLKGCCDKFEVKILGEGQ CVPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQADFLGLGTRPLGELLF SQDSFVPGRIEIARFTTESRLAQLAQSLAQNVEHELWGRRRYFHHDQEEMFVSEMFLPAA VQAMAKLKLD
Expression Region 1-190
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. Probable chorismate--pyruvate lyase(ubiC),E.coli
Code CSB-EP603644
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLKGCCDKFEVKILGEGQ CVPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQADFLGLGTRPLGELLF SQDSFVPGRIEIARFTTESRLAQLAQSLAQNVEHELWGRRRYFHHDQEEMFVSEMFLPAA VQAMAKLKLD
Expression Region 1-190
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. Probable chorismate--pyruvate lyase(ubiC),Baculovirus
Code CSB-BP603644
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLKGCCDKFEVKILGEGQ CVPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQADFLGLGTRPLGELLF SQDSFVPGRIEIARFTTESRLAQLAQSLAQNVEHELWGRRRYFHHDQEEMFVSEMFLPAA VQAMAKLKLD
Expression Region 1-190
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. Probable chorismate--pyruvate lyase(ubiC),Mammalian cell
Code CSB-MP603644
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSVTSLSFPYGESIQWFCADNAKNLPSSPLKEWLLAPGSLTQKLKGCCDKFEVKILGEGQ CVPLEGEYPKQNAVWVREVLLCLDSVPWVFARTLIPQSLLSTRQADFLGLGTRPLGELLF SQDSFVPGRIEIARFTTESRLAQLAQSLAQNVEHELWGRRRYFHHDQEEMFVSEMFLPAA VQAMAKLKLD
Expression Region 1-190
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.