Recombinant Shewanella sp. tRNA 2-thiocytidine biosynthesis protein TtcA(ttcA)

Product Type Recombinant Protein
Uniprot No. Q0HIM8
Abbreviation ttcA
Species Shewanella sp. (strain MR-4)
Gene Names ttcA
Protein Names Recommended name: tRNA 2-thiocytidine biosynthesis protein TtcA
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the ATP-dependent 2-thiolation of cytidine in position 32 of tRNA, to form 2-thiocytidine (s(2)C32). The sulfur atoms are provided by the cysteine/cysteine desulfurase (IscS) system.
Subcellular Location Cytoplasm
Protein Families TtcA family
Database Links

KEGG: she:Shewmr4_2016

Product Details for Different Expression Systems

Product Name Recombinant Shewanella sp. tRNA 2-thiocytidine biosynthesis protein TtcA(ttcA),Yeast
Code CSB-YP603612
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPEELSKKQITRLNKLQKRLRREVGSAIADYNMIEDGDRVMCCLSGGKDSYAMLDILLNL QQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEKDTYSIVKEKIPEGKTTC SLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYGGKMKAMPPKLLSDDGAN VVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQENLKRQAVKDMLNQWDRLYPGRIETI FTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGDVAEADLPAFDFLDIANSGHIDLDAAK RINIVNVYEA
Expression Region 1-310
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. tRNA 2-thiocytidine biosynthesis protein TtcA(ttcA),E.coli
Code CSB-EP603612
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPEELSKKQITRLNKLQKRLRREVGSAIADYNMIEDGDRVMCCLSGGKDSYAMLDILLNL QQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEKDTYSIVKEKIPEGKTTC SLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYGGKMKAMPPKLLSDDGAN VVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQENLKRQAVKDMLNQWDRLYPGRIETI FTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGDVAEADLPAFDFLDIANSGHIDLDAAK RINIVNVYEA
Expression Region 1-310
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. tRNA 2-thiocytidine biosynthesis protein TtcA(ttcA),Baculovirus
Code CSB-BP603612
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPEELSKKQITRLNKLQKRLRREVGSAIADYNMIEDGDRVMCCLSGGKDSYAMLDILLNL QQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEKDTYSIVKEKIPEGKTTC SLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYGGKMKAMPPKLLSDDGAN VVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQENLKRQAVKDMLNQWDRLYPGRIETI FTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGDVAEADLPAFDFLDIANSGHIDLDAAK RINIVNVYEA
Expression Region 1-310
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shewanella sp. tRNA 2-thiocytidine biosynthesis protein TtcA(ttcA),Mammalian cell
Code CSB-MP603612
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MPEELSKKQITRLNKLQKRLRREVGSAIADYNMIEDGDRVMCCLSGGKDSYAMLDILLNL QQRAPVQFEIIAVNLDQKQPGFPEHVLPAYLDSLNIPYHILEKDTYSIVKEKIPEGKTTC SLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETMFLNMFYGGKMKAMPPKLLSDDGAN VVIRPLAYCREKDLEEYAELKKFPIIPCNLCGSQENLKRQAVKDMLNQWDRLYPGRIETI FTAMQNTAPSQGVDREQFDFVSLKRDPNAPMKGDVAEADLPAFDFLDIANSGHIDLDAAK RINIVNVYEA
Expression Region 1-310
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.