Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
ipaD; CP0126; Invasin IpaD; 36 kDa membrane antigen
Species
Shigella flexneri
Expression Region
1-332aa
Target Protein Sequence
MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Shigella flexneri Invasin Ipad with an N-terminal 10xHis-SUMO-tag and a C-terminal Myc-tag is a full-length of protein expressed in E.coli. The sequence used to prepare this recombinant Ipad protein corresponds to residues Met1-Phe332 of Shigella flexneri Ipad. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 50-62 kDa was visualized on the gel under reducing conditions. In-stock Ipad proteins are offered. This recombinant Ipad protein may be used to produce antibodies against Ipad or in the studies of Ipad-related microbiology.
Invasion plasmid antigen D (Ipad) is a structural component that forms a complex at the tip of the Shigella type III secretion system (T3SS) apparatus needle. It is one of the predominant virulence factors of Shigella flexneri. Olivia Arizmendi etc. demonstrated that Ipad triggers apoptosis in macrophages through activation of host caspases accompanied by mitochondrial disruption during Shigella flexneri infection. And the N-terminal domain of the Ipad is necessary for macrophage killing.