Recombinant Shigella flexneri serotype 5b Putative ECA polymerase(wzyE)

Product Type Recombinant Protein
Uniprot No. Q0SYY4
Abbreviation wzyE
Species Shigella flexneri serotype 5b (strain 8401)
Gene Names wzyE
Protein Names Recommended name: Putative ECA polymerase
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Probably involved in the polymerization of enterobacterial common antigen (ECA) trisaccharide repeat units.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families WzyE family
Database Links

KEGG: sfv:SFV_3710

Product Details for Different Expression Systems

Product Name Recombinant Shigella flexneri serotype 5b Putative ECA polymerase(wzyE),Yeast
Code CSB-YP604084SGG
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR FDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRPLFTMNRVETNLTWVIL MGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVF IPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI IKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACL MIAKLLYWLFESAGLIHKRTKSSLRTQVEG
Expression Region 1-450
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shigella flexneri serotype 5b Putative ECA polymerase(wzyE),E.coli
Code CSB-EP604084SGG
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR FDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRPLFTMNRVETNLTWVIL MGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVF IPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI IKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACL MIAKLLYWLFESAGLIHKRTKSSLRTQVEG
Expression Region 1-450
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shigella flexneri serotype 5b Putative ECA polymerase(wzyE),Baculovirus
Code CSB-BP604084SGG
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR FDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRPLFTMNRVETNLTWVIL MGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVF IPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI IKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACL MIAKLLYWLFESAGLIHKRTKSSLRTQVEG
Expression Region 1-450
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Shigella flexneri serotype 5b Putative ECA polymerase(wzyE),Mammalian cell
Code CSB-MP604084SGG
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR FDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRPLFTMNRVETNLTWVIL MGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVF IPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI IKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACL MIAKLLYWLFESAGLIHKRTKSSLRTQVEG
Expression Region 1-450
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.