Recombinant Sistrurus catenatus edwardsii C-type lectin isoform 1

Product Type Recombinant Protein
Uniprot No. B0VXV0
Species Sistrurus catenatus edwardsii (Desert massasauga) (Crotalophorus edwardsii)
Protein Names Recommended name: C-type lectin isoform 1
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Interferes with one step of hemostasis (modulation of platelet aggregation, or coagulation cascade, for example).
Subcellular Location Secreted
Protein Families Snaclec family
Tissue Specificity Expressed by the venom gland.

Product Details for Different Expression Systems

Product Name Recombinant Sistrurus catenatus edwardsii C-type lectin isoform 1,Yeast
Code CSB-YP535224SZP
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DCPSDWSSYEGHCYRVFQQEMTWEAAEQFCAQQRKESHLVSFHSSEEVDFLVSITYPILK ADLVWIGLRDIWNECRLEWTDGTKVDYKEWSEEPECIVSKTTDNQWISRPCSRTYSFVCK FQA
Expression Region 24-146
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii C-type lectin isoform 1,E.coli
Code CSB-EP535224SZP
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DCPSDWSSYEGHCYRVFQQEMTWEAAEQFCAQQRKESHLVSFHSSEEVDFLVSITYPILK ADLVWIGLRDIWNECRLEWTDGTKVDYKEWSEEPECIVSKTTDNQWISRPCSRTYSFVCK FQA
Expression Region 24-146
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii C-type lectin isoform 1,Baculovirus
Code CSB-BP535224SZP
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DCPSDWSSYEGHCYRVFQQEMTWEAAEQFCAQQRKESHLVSFHSSEEVDFLVSITYPILK ADLVWIGLRDIWNECRLEWTDGTKVDYKEWSEEPECIVSKTTDNQWISRPCSRTYSFVCK FQA
Expression Region 24-146
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii C-type lectin isoform 1,Mammalian cell
Code CSB-MP535224SZP
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence DCPSDWSSYEGHCYRVFQQEMTWEAAEQFCAQQRKESHLVSFHSSEEVDFLVSITYPILK ADLVWIGLRDIWNECRLEWTDGTKVDYKEWSEEPECIVSKTTDNQWISRPCSRTYSFVCK FQA
Expression Region 24-146
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.