Recombinant Sistrurus catenatus edwardsii Snake venom vascular endothelial growth factor toxin 2

Product Type Recombinant Protein
Uniprot No. B0VXV4
Species Sistrurus catenatus edwardsii (Desert massasauga) (Crotalophorus edwardsii)
Protein Names Recommended name: Snake venom vascular endothelial growth factor toxin 2 Short name= svVEGF
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Induces capillary permeability and angiogenesis through VEGF receptor (KDR/VEGFR-2) signaling.
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family, Snake venom VEGF subfamily
Tissue Specificity Expressed by the venom gland.

Product Details for Different Expression Systems

Product Name Recombinant Sistrurus catenatus edwardsii Snake venom vascular endothelial growth factor toxin 2,Yeast
Code CSB-YP535225SZP
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QAMPFMEVFERSVCQTREMLVSILDEHPDEVAHLFRPSCVTVLRCGGCCTDESLMCTATG KRSVGREIMRVDPRKETSKIEVMQFTEHTECECRPRSGRVNSGKRKRNPEEGGAESQVPL GLTSF
Expression Region 25-149
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii Snake venom vascular endothelial growth factor toxin 2,E.coli
Code CSB-EP535225SZP
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QAMPFMEVFERSVCQTREMLVSILDEHPDEVAHLFRPSCVTVLRCGGCCTDESLMCTATG KRSVGREIMRVDPRKETSKIEVMQFTEHTECECRPRSGRVNSGKRKRNPEEGGAESQVPL GLTSF
Expression Region 25-149
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii Snake venom vascular endothelial growth factor toxin 2,Baculovirus
Code CSB-BP535225SZP
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QAMPFMEVFERSVCQTREMLVSILDEHPDEVAHLFRPSCVTVLRCGGCCTDESLMCTATG KRSVGREIMRVDPRKETSKIEVMQFTEHTECECRPRSGRVNSGKRKRNPEEGGAESQVPL GLTSF
Expression Region 25-149
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Sistrurus catenatus edwardsii Snake venom vascular endothelial growth factor toxin 2,Mammalian cell
Code CSB-MP535225SZP
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence QAMPFMEVFERSVCQTREMLVSILDEHPDEVAHLFRPSCVTVLRCGGCCTDESLMCTATG KRSVGREIMRVDPRKETSKIEVMQFTEHTECECRPRSGRVNSGKRKRNPEEGGAESQVPL GLTSF
Expression Region 25-149
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.