Recombinant Synechococcus sp. Phosphomethylpyrimidine synthase(thiC)

Product Type Recombinant Protein
Uniprot No. Q0IDV6
Abbreviation thiC
Species Synechococcus sp. (strain CC9311)
Gene Names thiC
Protein Names Recommended name: Phosphomethylpyrimidine synthase EC= 4.1.99.17 Alternative name(s): Hydroxymethylpyrimidine phosphate synthase Short name= HMP-P synthase Short name= HMP-phosphate synthase Short name= HMPP synthase
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the synthesis of the hydroxymethylpyrimidine phosphate (HMP-P) moiety of thiamine from aminoimidazole ribotide (AIR) in a radical S-adenosyl-L-methionine (SAM)-dependent reaction.
Protein Families ThiC family
Database Links

KEGG: syg:sync_0129

STRING: 64471.sync_0129

Product Details for Different Expression Systems

Product Name Recombinant Synechococcus sp. Phosphomethylpyrimidine synthase(thiC),Yeast
Code CSB-YP603778
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVMEEVARGRMIIPANVN HTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYGADTVMDLSTGGVNLDE VRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEKHCQQGVDYQTIHAGLLI EHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDICEIFKRYDCTFSLGDSLRP GCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVPLDQIEFNVKKQMEECNEAP FYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTPKEHLGLPNAEDVREGLIAYK IAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSLDPERAKEYHDETLPADIYKQA EFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELVGVKQDKL
Expression Region 1-465
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Phosphomethylpyrimidine synthase(thiC),E.coli
Code CSB-EP603778
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVMEEVARGRMIIPANVN HTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYGADTVMDLSTGGVNLDE VRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEKHCQQGVDYQTIHAGLLI EHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDICEIFKRYDCTFSLGDSLRP GCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVPLDQIEFNVKKQMEECNEAP FYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTPKEHLGLPNAEDVREGLIAYK IAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSLDPERAKEYHDETLPADIYKQA EFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELVGVKQDKL
Expression Region 1-465
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Phosphomethylpyrimidine synthase(thiC),Baculovirus
Code CSB-BP603778
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVMEEVARGRMIIPANVN HTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYGADTVMDLSTGGVNLDE VRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEKHCQQGVDYQTIHAGLLI EHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDICEIFKRYDCTFSLGDSLRP GCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVPLDQIEFNVKKQMEECNEAP FYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTPKEHLGLPNAEDVREGLIAYK IAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSLDPERAKEYHDETLPADIYKQA EFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELVGVKQDKL
Expression Region 1-465
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Phosphomethylpyrimidine synthase(thiC),Mammalian cell
Code CSB-MP603778
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVMEEVARGRMIIPANVN HTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYGADTVMDLSTGGVNLDE VRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEKHCQQGVDYQTIHAGLLI EHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDICEIFKRYDCTFSLGDSLRP GCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVPLDQIEFNVKKQMEECNEAP FYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTPKEHLGLPNAEDVREGLIAYK IAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSLDPERAKEYHDETLPADIYKQA EFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELVGVKQDKL
Expression Region 1-465
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.