Recombinant Synechococcus sp. Putative membrane protein insertion efficiency factor(sync_0630)

Product Type Recombinant Protein
Uniprot No. Q0ICH4
Abbreviation sync_0630
Species Synechococcus sp. (strain CC9311)
Gene Names sync_0630
Protein Names Recommended name: Putative membrane protein insertion efficiency factor
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Could be involved in insertion of integral membrane proteins into the membrane.
Subcellular Location Cell inner membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families UPF0161 family
Database Links

KEGG: syg:sync_0630

STRING: 64471.sync_0630

Product Details for Different Expression Systems

Product Name Recombinant Synechococcus sp. Putative membrane protein insertion efficiency factor(sync_0630),Yeast
Code CSB-YP603767
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MHESTILSAGSTNPFNRIVSAVMLALIELYRRWISPLIGPRCRFIPTCSAYGIEAIQRHG PWRGGWLTLRRLLRCHPFTPCGCDPVPD
Expression Region 1-88
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Putative membrane protein insertion efficiency factor(sync_0630),E.coli
Code CSB-EP603767
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MHESTILSAGSTNPFNRIVSAVMLALIELYRRWISPLIGPRCRFIPTCSAYGIEAIQRHG PWRGGWLTLRRLLRCHPFTPCGCDPVPD
Expression Region 1-88
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Putative membrane protein insertion efficiency factor(sync_0630),Baculovirus
Code CSB-BP603767
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MHESTILSAGSTNPFNRIVSAVMLALIELYRRWISPLIGPRCRFIPTCSAYGIEAIQRHG PWRGGWLTLRRLLRCHPFTPCGCDPVPD
Expression Region 1-88
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Synechococcus sp. Putative membrane protein insertion efficiency factor(sync_0630),Mammalian cell
Code CSB-MP603767
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MHESTILSAGSTNPFNRIVSAVMLALIELYRRWISPLIGPRCRFIPTCSAYGIEAIQRHG PWRGGWLTLRRLLRCHPFTPCGCDPVPD
Expression Region 1-88
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.