Recombinant V-type ATP synthase beta chain(atpB)

Product Type Recombinant Protein
Uniprot No. Q0W362
Abbreviation atpB
Species Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Gene Names atpB
Protein Names Recommended name: V-type ATP synthase beta chain Alternative name(s): V-ATPase subunit B
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit.
Protein Families ATPase alpha/beta chains family
Database Links

KEGG: rci:RCIX2032

STRING: 351160.RCIX2032

Product Details for Different Expression Systems

Product Name Recombinant V-type ATP synthase beta chain(atpB),Yeast
Code CSB-YP604462
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKEYKTISEIAGPLLFVRKTEPVGYQELVNIVLSDGTVKRGQVLDSSNDVVAVQVFEGTS GISRDSSVKFLGETIKMPVSKDMLGRILSGSGEPLDGGPAIIPEKRLEIVGAAINPYSRR QPKDFIQTGISTIDGMNTLVRGQKLPIFSGSGLPHNEIALQIARQAKVVGSTEPFAVVFC AMGITAEEAQTFMKDFERTGALERAVVFLNLADDPAIERIITPRLALTTAEYLAFEHDMH VLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAQLYERAGIIEGKKGSITQVP ILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKNIYPPINVSPSLSRLMSLGIGAGKTR EDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRQFLEFADAFEDKFVRQGREEDRS IEQTLDLAWELLSMLPINALNKIDNKYIEKYHPSKRKK
Expression Region 1-458
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant V-type ATP synthase beta chain(atpB),E.coli
Code CSB-EP604462
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKEYKTISEIAGPLLFVRKTEPVGYQELVNIVLSDGTVKRGQVLDSSNDVVAVQVFEGTS GISRDSSVKFLGETIKMPVSKDMLGRILSGSGEPLDGGPAIIPEKRLEIVGAAINPYSRR QPKDFIQTGISTIDGMNTLVRGQKLPIFSGSGLPHNEIALQIARQAKVVGSTEPFAVVFC AMGITAEEAQTFMKDFERTGALERAVVFLNLADDPAIERIITPRLALTTAEYLAFEHDMH VLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAQLYERAGIIEGKKGSITQVP ILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKNIYPPINVSPSLSRLMSLGIGAGKTR EDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRQFLEFADAFEDKFVRQGREEDRS IEQTLDLAWELLSMLPINALNKIDNKYIEKYHPSKRKK
Expression Region 1-458
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant V-type ATP synthase beta chain(atpB),Baculovirus
Code CSB-BP604462
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKEYKTISEIAGPLLFVRKTEPVGYQELVNIVLSDGTVKRGQVLDSSNDVVAVQVFEGTS GISRDSSVKFLGETIKMPVSKDMLGRILSGSGEPLDGGPAIIPEKRLEIVGAAINPYSRR QPKDFIQTGISTIDGMNTLVRGQKLPIFSGSGLPHNEIALQIARQAKVVGSTEPFAVVFC AMGITAEEAQTFMKDFERTGALERAVVFLNLADDPAIERIITPRLALTTAEYLAFEHDMH VLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAQLYERAGIIEGKKGSITQVP ILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKNIYPPINVSPSLSRLMSLGIGAGKTR EDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRQFLEFADAFEDKFVRQGREEDRS IEQTLDLAWELLSMLPINALNKIDNKYIEKYHPSKRKK
Expression Region 1-458
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant V-type ATP synthase beta chain(atpB),Mammalian cell
Code CSB-MP604462
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKEYKTISEIAGPLLFVRKTEPVGYQELVNIVLSDGTVKRGQVLDSSNDVVAVQVFEGTS GISRDSSVKFLGETIKMPVSKDMLGRILSGSGEPLDGGPAIIPEKRLEIVGAAINPYSRR QPKDFIQTGISTIDGMNTLVRGQKLPIFSGSGLPHNEIALQIARQAKVVGSTEPFAVVFC AMGITAEEAQTFMKDFERTGALERAVVFLNLADDPAIERIITPRLALTTAEYLAFEHDMH VLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAQLYERAGIIEGKKGSITQVP ILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKNIYPPINVSPSLSRLMSLGIGAGKTR EDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRQFLEFADAFEDKFVRQGREEDRS IEQTLDLAWELLSMLPINALNKIDNKYIEKYHPSKRKK
Expression Region 1-458
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.