Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4)

Product Type Recombinant Protein
Uniprot No. Q0ZJ09
Abbreviation ycf4
Species Vitis vinifera (Grape)
Gene Names ycf4
Protein Names Recommended name: Photosystem I assembly protein Ycf4
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Seems to be required for the assembly of the photosystem I complex.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein
Protein Families Ycf4 family
Database Links

KEGG: vvi:4025048

STRING: 29760.VIT_12s0059g02430.t01

Product Details for Different Expression Systems

Product Name Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),Yeast
Code CSB-YP604527VFQ
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSWRSERIWIELITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRL LMKDIQSIRIAVKEDIYARRILVLYMEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLR VPIEVF
Expression Region 1-186
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),E.coli
Code CSB-EP604527VFQ
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSWRSERIWIELITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRL LMKDIQSIRIAVKEDIYARRILVLYMEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLR VPIEVF
Expression Region 1-186
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),Baculovirus
Code CSB-BP604527VFQ
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSWRSERIWIELITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRL LMKDIQSIRIAVKEDIYARRILVLYMEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLR VPIEVF
Expression Region 1-186
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Vitis vinifera Photosystem I assembly protein Ycf4(ycf4),Mammalian cell
Code CSB-MP604527VFQ
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSWRSERIWIELITGSRKTSNFCWAFILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRL LMKDIQSIRIAVKEDIYARRILVLYMEIRGQGAIPLTRTDENLTPREMEQKAAELAYFLR VPIEVF
Expression Region 1-186
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.