Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF289(ORF289)

Code CSB-CF701154ADAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q573C7
Storage Buffer Tris-based buffer,50% glycerol
Species Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)
Sequence MAIAKEFLLTVLNYIANGVVNVQSSTTQAVTTLAPYQIIAIMKNNNVTVSRTTITSISVS DVVNASQEETLTIRYSGTDASPFTYTTDEIEIWASTQSALLYKIADIQLQTPLSKTEHDY LNIEYEIIITAGASYTTTSSMSQYTSVVTFRTLVAPILYFFALFLVPAWSTVLKQNPTFP QSQLSNYISPSSYQGINAMYVGSNQVTIVSKLVGFGTTTVSIVVNGEVTSTQVNAPIFIG VTTPSGVLVLAYNYYSGTISKYVSLTVTTTYGSATVINQFETKTTGGTT
Source in vitro E.coli expression system
Gene Names ORF289
Protein Names Recommended name: Putative transmembrane protein ORF289
Expression Region 1-289
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Multi-pass membrane protein
Database Links

KEGG: vg:5656093

Related Products

ORF289 Proteins

ORF289 Proteins for Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.