Recombinant African swine fever virus Cysteine-rich protein E199L (Ken-142)

Code CSB-CF315330AEB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CA94
Storage Buffer Tris-based buffer,50% glycerol
Species African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Sequence MSCTPVSTKCNDIWIDFSCTGPSVSELQKKEPNAWAAILRSQKNQQTAEDDTIIGSICDK QGLCSKDEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEQRNILTNKQCPSGLTIC QNIAEYGGTGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILVIIYRLMSSSAAK QNGDKLPPPSLIFSNLNNF
Source in vitro E.coli expression system
Gene Names Ken-142
Protein Names Recommended name: Cysteine-rich protein E199L Short name= pE199L
Expression Region 1-199
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Virion, Host membrane, Single-pass membrane protein
Protein Families Asfivirus E199L family

Related Products

Ken-142 Proteins

Ken-142 Proteins for African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.