Recombinant Agrobacterium tumefaciens Protein virB6(virB6)

Code CSB-CF323806AYS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P17796
Storage Buffer Tris-based buffer,50% glycerol
Species Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Sequence MNFTIPAPFTAIHTIFDLAFTTSLDTMLGTIQEAVSAPLVACVTLWIIVQGILVMRGEID TRGGITRVITVTVVVALVVGQANYHDYVVSVFEETIPNFIQQFSGSGLPLQTIPAQLDTM FALTQAAFQRIASEIGPMNDQDILAFQGAQWVFYGTLWSAFGIYDAVGILTKVLLAIGPL ILTGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLGVITLAGTTA AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSANSLYRRFAQVDRR
Source in vitro E.coli expression system
Gene Names virB6
Protein Names Recommended name: Protein virB6
Expression Region 1-295
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function VirB proteins are suggested to act at the bacterial surface and there play an important role in directing T-DNA transfer to plant cells.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: atu:Atu6172

Related Products

virB6 Proteins

virB6 Proteins for Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.