Recombinant Ajellomyces capsulata Solute carrier family 25 member 38 homolog (HCAG_06120)

Code CSB-CF410693AUN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6RAY2
Storage Buffer Tris-based buffer,50% glycerol
Species Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Sequence MLATADMSDGYTNGARLKISTSSKPKFHFIAGLASGLSSAILLQPADLLKTRIQQAHQTS ALLFTIRKILASPQPIRGLWRGTLPSALRTGFGSALYFSSLNALRQCIANQGALVPLHGD RDDKRTRTSALPKLSHTANLLTGAMARTAAGFIMMPVTVIKVRYESDYYAYRSIWGAGRD IVRSEGFRGLFSGFGATAIRDAPYAGLYVVFYEQSKKNLNALNFGGLTTARPLSDEPARE DNSEKQLVTSSISVNFVSGALAAGLATSITNPFDVVKTRLQLMPNKYRNMAHAVRLVLRE DGVRSLFGGLGLRMGRKAISSALAWTVYEELILKAEKRWPDQDNIEQLTP
Source in vitro E.coli expression system
Gene Names HCAG_06120
Protein Names Recommended name: Solute carrier family 25 member 38 homolog
Expression Region 1-350
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Database Links

KEGG: aje:HCAG_06120

STRING: 339724.XP_001538515.1

Related Products

HCAG_06120 Proteins

HCAG_06120 Proteins for Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.