Recombinant Akkermansia muciniphila Sec-independent protein translocase protein TatC(tatC)

Code CSB-CF454961AZF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B2UN92
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Sequence MLLRMALCLTVSTILCAGFASNLMDILRRPVNQVWDMFEESHLPAGIGLDAWSKAKEMAT AMTSLGASQRALFLRQVSPSQADLTEAALVLRGAQPLPEDRKQVFIREGSPSTAVRDLAE ALYSKGAVLADGTGRGALKMMSAFQPGEAFMLTIKLSLYAGVVISFPLLLYFLLQFIIPG LLEHERKLLYKCMAVGFGLFLAGTLFCYFIVLPRVLTFFYTYSLEFGISNEWRIGYYLSF ATQMILMFGLAFELPVVVMPFVKLGVLTYDMMKSTRRYAIVAIAVLAAVITPTPDVATMM LMAVPMYALYEICIILAWMHERKEAARTREEIARFEEDFNNNNSPYNQ
Source in vitro E.coli expression system
Gene Names tatC
Protein Names Recommended name: Sec-independent protein translocase protein TatC
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families TatC family
Database Links

KEGG: amu:Amuc_1889

STRING: 349741.Amuc_1889

Related Products

tatC Proteins

tatC Proteins for Akkermansia muciniphila (strain ATCC BAA-835 / Muc)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.