Recombinant Aneurinibacillus migulanus Sensor protein gtcS(gtcS)

Code CSB-CF669319AKF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q44930
Storage Buffer Tris-based buffer,50% glycerol
Species Aneurinibacillus migulanus (Bacillus migulanus)
Sequence MITAYILFTVTVGVTNSIVFYLDDHIGTRHFKKRVYCSSAWIVAWRLMEMVIFALSVYLY SRWTSKRITGPLEKITDAIQKMREGEFAQRLCFKADYELTLIQEHFNEMVAHLEKTEAEK NKLEQSKQRMLLDLSHDFKTPITTIQGYAMALQMGVVDSPEKQRRYLEMIYNKSIIVTAL VEDMFQLATLDSPDLPSAEEHGRFGRTGSEIAIAYFDQFEQNKFSLDLKIPTQRVMIRMN RNLLYRALSNLLSNTLKHNPKGTKVALSLTDTHEAILLEVMDNGIGIAEELKESIFQPFV RGDKARTGEGTGLGLPSPKKRLNFMVESCCSRVNQGKQYSRSFSQRLENDLPYRLPYHRM NKFHRNANQQ
Source in vitro E.coli expression system
Gene Names gtcS
Protein Names Recommended name: Sensor protein gtcS EC= 2.7.13.3
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system GtcS/GtcR which may act in the control of the transcription of the grs operon which encodes the multienzymes involved in the biosynthesis of the peptide antibiotic gramicidin S. Probably activates GtcR by phosphorylation.
Subcellular Location Cell membrane, Multi-pass membrane protein

Related Products

gtcS Proteins

gtcS Proteins for Aneurinibacillus migulanus (Bacillus migulanus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.