Recombinant Anopheles gambiae Gustatory and odorant receptor 7(GPRor7)

Code CSB-CF766395BZL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7QCC7
Storage Buffer Tris-based buffer,50% glycerol
Species Anopheles gambiae (African malaria mosquito)
Sequence MQVQPTKYVGLVADLMPNIRLMQASGHFLFRYVTGPILIRKVYSWWTLAMVLIQFFAILG NLATNADDVNELTANTITTLFFTHSVTKFIYFAVNSENFYRTLAIWNQTNTHPLFAESDA RYHSIALAKMRKLLVLVMATTVLSVVAWVTITFFGESVKTVLDKATNETYTVDIPRLPIK SWYPWNAMSGPAYIFSFIYQIYFLLFSMVQSNLADVMFCSWLLLACEQLQHLKGIMRSLM ELSASLDTYRPNSSQLFRAISAGSKSELIINEEKDPDVKDFDLSGIYSSKADWGAQFRAP STLQTFDENGRNGNPNGLTRKQEMMVRSAIKYWVERHKHVVRLVSAIGDTYGPALLLHML TSTIKLTLLAYQATKIDGVNVYGLTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYS CHWYDGSEEAKTFVQIVCQQCQKAMTISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK
Source in vitro E.coli expression system
Gene Names Orco
Protein Names Recommended name: Gustatory and odorant receptor 7 Alternative name(s): AgOr7
Expression Region 1-478
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant coreceptor which complexes with conventional odorant receptors (ORs) to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Orco is a universal and integral part of the functional odorant receptor, involved in the dendritic localization of other olfactory receptors. Can form functional ion channels in the absence of an odor-binding OR. Plays a key role in preferred attraction of females for humans over non-human hosts for blood feeding. Human attraction plays a crucial role in the transmission of Plasmodium protozoans by the mosquito leading to infection diseases like malaria. Also required for the response to N,N-Diethyl-meta-toluamide (DEET), the most widely used insect repellent worldwide.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Orco subfamily
Tissue Specificity Expressed in olfactory and gustatory organs of both adult and immature stages. Highest expression is seen in adult antennae and the maxillary palps. Lower expression also seen in proboscis and legs. Within the antenna, expression originates in cell bodies
Database Links

KEGG: aga:AgaP_AGAP002560

STRING: 7165.AGAP002560-PA

Related Products

Orco Proteins

Orco Proteins for Anopheles gambiae (African malaria mosquito)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.