Recombinant Anopheles gambiae Odorant receptor Or1(OR1)

Code CSB-CF823874BZL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8WTE7
Storage Buffer Tris-based buffer,50% glycerol
Species Anopheles gambiae (African malaria mosquito)
Sequence MKLNKLNPRWDAYDRRDSFWLQLLCLKYLGLWPPEDTDQATRNRYIAYGWALRIMFLHLY ALTQALYFKDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYHPKQ REEFSPVLQSMSGVFWLMIFLMFVAIFTIIMWVMSPAFDNERRLPVPAWFPVDYHHSDIV YGVLFLYQTIGIVMSATYNFSTDTMFSGLMLHINGQIVRLGSMVKKLGHDVPPERQLVAT DAEWKEMRKRIDHHSKVYGTMYAKVTECVLFHKDILSFGDEVQDIFQGSIFAQVCASVII ICMTLLQATGDDVTMADLLGCGFYLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFK FDKRTSQAMIFFLQMTLKDVHIKVGSVLKVTLNLHTFLQIMKLSYSYLAVLQSMESE
Source in vitro E.coli expression system
Gene Names OR1
Protein Names Recommended name: Odorant receptor Or1 Alternative name(s): AgOr1
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which plays a critical role in the anthropophilic host-seeking behavior; establishes the host preference to transmit malaria. May participate in the phenomenon of decreased host-seeking behavior in disease vector mosquitoes after blood feeding.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Female-specific antennae and maxillary palp expression.
Database Links

KEGG: aga:AgaP_AGAP009640

STRING: 7165.AGAP009640-PA

Related Products

OR1 Proteins

OR1 Proteins for Anopheles gambiae (African malaria mosquito)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.