Recombinant Aquifex aeolicus ATP synthase subunit a(atpB)

Code CSB-CF015070DNV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O66566
Storage Buffer Tris-based buffer,50% glycerol
Species Aquifex aeolicus (strain VF5)
Sequence MEYSHVVYALLAVALAIIFVLKGGKPSLKPTKYQALLEGYLRFVRNMLLENVGERGLKYV PLIAAIGLFVFFGNILGMVPGFEAPTANINTNLALALLVFFYYHFEGFRENGLAYLKHFM GPIPLMAPFFFVVEVISHIARPITLSLRLFANMKAGALLLLTLVSLVIKNPFTLVVSPVV LIFVIAIKFLAIFIQTYIFMILSVVYIAGAVAHEEH
Source in vitro E.coli expression system
Gene Names atpB
Protein Names Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6
Expression Region 1-216
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ATPase A chain family
Database Links

KEGG: aae:aq_179

STRING: 224324.aq_179

Related Products

atpB Proteins

atpB Proteins for Aquifex aeolicus (strain VF5)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.